Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online
product-image-AAA28271_IHC6.jpg IHC (Immunohistchemistry) (Immunohistochemistry of paraffin-embedded mouse stomach using SULT2A1 Antibody at dilution of 1:200 (40x lens).)

Rabbit SULT2A1 Polyclonal Antibody | anti-SULT2A1 antibody

SULT2A1 Polyclonal Antibody

Gene Names
SULT2A1; HST; ST2; STD; hSTa; DHEAS; ST2A1; ST2A3; DHEA-ST
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purification
Synonyms
SULT2A1, Antibody; SULT2A1 Polyclonal Antibody; DHEA-ST; DHEAS; HST; hSTa; ST2; ST2A1; ST2A3; STD; anti-SULT2A1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MSDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKS
Sequence Length
285
Applicable Applications for anti-SULT2A1 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
WB: 1:500 - 1:2000
IHC: 1:50 - 1:200
Immunogen
Recombinant protein of human SULT2A1
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cytoplasm
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

IHC (Immunohistchemistry)

(Immunohistochemistry of paraffin-embedded mouse stomach using SULT2A1 Antibody at dilution of 1:200 (40x lens).)

product-image-AAA28271_IHC6.jpg IHC (Immunohistchemistry) (Immunohistochemistry of paraffin-embedded mouse stomach using SULT2A1 Antibody at dilution of 1:200 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded mouse kidney using SULT2A1 Antibody at dilution of 1:200 (40x lens).)

product-image-AAA28271_IHC5.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded mouse kidney using SULT2A1 Antibody at dilution of 1:200 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded mouse spleen using SULT2A1 Antibody at dilution of 1:200 (40x lens).)

product-image-AAA28271_IHC4.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded mouse spleen using SULT2A1 Antibody at dilution of 1:200 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human gastric cancer using SULT2A1 Antibody at dilution of 1:200 (40x lens).)

product-image-AAA28271_IHC3.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human gastric cancer using SULT2A1 Antibody at dilution of 1:200 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded rat kidney using SULT2A1 Antibody at dilution of 1:200 (40x lens).)

product-image-AAA28271_IHC2.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded rat kidney using SULT2A1 Antibody at dilution of 1:200 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of mouse skeletal muscle, using SULT2A1 antibody at 1:2000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 50s.)

product-image-AAA28271_WB.jpg WB (Western Blot) (Western blot analysis of extracts of mouse skeletal muscle, using SULT2A1 antibody at 1:2000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 50s.)
Related Product Information for anti-SULT2A1 antibody
This gene encodes a member of the sulfotransferase family. Sulfotransferases aid in the metabolism of drugs and endogenous compounds by converting these substances into more hydrophilic water-soluble sulfate conjugates that can be easily excreted. This protein catalyzes the sulfation of steroids and bile acids in the liver and adrenal glands, and may have a role in the inherited adrenal androgen excess in women with polycystic ovary syndrome.
Product Categories/Family for anti-SULT2A1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 33kDa
Observed: 28kDa
NCBI Official Full Name
bile salt sulfotransferase
NCBI Official Synonym Full Names
sulfotransferase family 2A member 1
NCBI Official Symbol
SULT2A1
NCBI Official Synonym Symbols
HST; ST2; STD; hSTa; DHEAS; ST2A1; ST2A3; DHEA-ST
NCBI Protein Information
bile salt sulfotransferase
UniProt Protein Name
Bile salt sulfotransferase
UniProt Gene Name
SULT2A1
UniProt Synonym Gene Names
HST; STD; DHEA-ST; HST; ST2A1

Similar Products

Product Notes

The SULT2A1 sult2a1 (Catalog #AAA28271) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SULT2A1 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SULT2A1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). WB: 1:500 - 1:2000 IHC: 1:50 - 1:200. Researchers should empirically determine the suitability of the SULT2A1 sult2a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSDDFLWFEG IAFPTMGFRS ETLRKVRDEF VIRDEDVIIL TYPKSGTNWL AEILCLMHSK GDAKWIQSVP IWERSPWVES EIGYTALSET ESPRLFSSHL PIQLFPKSFF SSKAKVIYLM RNPRDVLVSG YFFWKNMKFI KKPKS. It is sometimes possible for the material contained within the vial of "SULT2A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.