Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA19224_FCM7.png FCM (Flow Cytometry) (Figure 7. Flow Cytometry analysis of HL-60 cells using anti-Sumo 1/SUMO1 antibody (AAA19224).Overlay histogram showing HL-60 cells stained with AAA19224 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-Sumo 1/SUMO1 Antibody (AAA19224, 1μg/1x106 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

Rabbit Sumo 1/SUMO1 Polyclonal Antibody | anti-SUMO1 antibody

Anti-Sumo 1/SUMO1 Antibody

Average rating 0.0
No ratings yet
Gene Names
SUMO1; DAP1; GMP1; PIC1; SMT3; UBL1; OFC10; SENP2; SMT3C; SMT3H3
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Flow Cytometry, Functional Assay
Purity
Immunogen affinity purified.
Synonyms
Sumo 1/SUMO1, Antibody; Anti-Sumo 1/SUMO1 Antibody; SUMO1; SMT3C; SMT3H3; UBL1; OK/SW-cl. 43; Small ubiquitin-related modifier 1; SUMO-1; GAP-modifying protein 1; GMP1; SMT3 homolog 3; Sentrin; Ubiquitin-homology domain protein PIC1; Ubiquitin-like protein SMT3C; Smt3C; Ubiquitin-like protein UBL1; small ubiquitin-like modifier 1; anti-SUMO1 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
Rabbit IgG
Specificity
Rabbit IgG polyclonal antibody for Sumo 1/SUMO1 detection.
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized. Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.005mg NaN3.
Applicable Applications for anti-SUMO1 antibody
IHC (Immunohistochemistry), ICC (Immunocytochemistry), IF (Immunofluorescence), FCM/FACS (Flow Cytometry)
Application Notes
IHC-P: 1-2ug/ml|Human, Mouse, Rat|
ICC/IF: 5ug/ml|Human|
FC/FACS/FCM: 1-3ug/1x106 cells|Mouse|
Immunogen
A synthetic peptide corresponding to a sequence of human Sumo 1/SUMO1 (HLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKEL).
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Recommended Detection Systems
Recommended Detection Systems
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

FCM (Flow Cytometry)

(Figure 7. Flow Cytometry analysis of HL-60 cells using anti-Sumo 1/SUMO1 antibody (AAA19224).Overlay histogram showing HL-60 cells stained with AAA19224 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-Sumo 1/SUMO1 Antibody (AAA19224, 1μg/1x106 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

product-image-AAA19224_FCM7.png FCM (Flow Cytometry) (Figure 7. Flow Cytometry analysis of HL-60 cells using anti-Sumo 1/SUMO1 antibody (AAA19224).Overlay histogram showing HL-60 cells stained with AAA19224 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-Sumo 1/SUMO1 Antibody (AAA19224, 1μg/1x106 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

IF (Immunofluorescence)

(Figure 6. IF analysis of Sumo 1/SUMO1 using anti- Sumo 1/SUMO1 antibody (AAA19224).Sumo 1/SUMO1 was detected in immunocytochemical section of A431 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 5μg/mL rabbit anti-Sumo 1/SUMO1 Antibody (AAA19224) overnight at 4 degree C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37 degree C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.)

product-image-AAA19224_IF6.jpg IF (Immunofluorescence) (Figure 6. IF analysis of Sumo 1/SUMO1 using anti- Sumo 1/SUMO1 antibody (AAA19224).Sumo 1/SUMO1 was detected in immunocytochemical section of A431 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 5μg/mL rabbit anti-Sumo 1/SUMO1 Antibody (AAA19224) overnight at 4 degree C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37 degree C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.)

IHC (Immunohistochemistry)

(Figure 5. IHC analysis of Sumo 1/SUMO1 using anti-Sumo 1/SUMO1 antibody (AAA19224).Sumo 1/SUMO1 was detected in paraffin-embedded section of human mammary cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-Sumo 1/SUMO1 Antibody (AAA19224) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.)

product-image-AAA19224_IHC5.jpg IHC (Immunohistochemistry) (Figure 5. IHC analysis of Sumo 1/SUMO1 using anti-Sumo 1/SUMO1 antibody (AAA19224).Sumo 1/SUMO1 was detected in paraffin-embedded section of human mammary cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-Sumo 1/SUMO1 Antibody (AAA19224) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 4. IHC analysis of Sumo 1/SUMO1 using anti-Sumo 1/SUMO1 antibody (AAA19224).Sumo 1/SUMO1 was detected in paraffin-embedded section of human intestinal cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-Sumo 1/SUMO1 Antibody (AAA19224) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.)

product-image-AAA19224_IHC4.jpg IHC (Immunohistochemistry) (Figure 4. IHC analysis of Sumo 1/SUMO1 using anti-Sumo 1/SUMO1 antibody (AAA19224).Sumo 1/SUMO1 was detected in paraffin-embedded section of human intestinal cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-Sumo 1/SUMO1 Antibody (AAA19224) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 3. IHC analysis of Sumo 1/SUMO1 using anti-Sumo 1/SUMO1 antibody (AAA19224).Sumo 1/SUMO1 was detected in paraffin-embedded section of rat brain tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-Sumo 1/SUMO1 Antibody (AAA19224) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.)

product-image-AAA19224_IHC3.jpg IHC (Immunohistochemistry) (Figure 3. IHC analysis of Sumo 1/SUMO1 using anti-Sumo 1/SUMO1 antibody (AAA19224).Sumo 1/SUMO1 was detected in paraffin-embedded section of rat brain tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-Sumo 1/SUMO1 Antibody (AAA19224) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 2. IHC analysis of Sumo 1/SUMO1 using anti-Sumo 1/SUMO1 antibody (AAA19224).Sumo 1/SUMO1 was detected in paraffin-embedded section of mouse brain tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-Sumo 1/SUMO1 Antibody (AAA19224) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.)

product-image-AAA19224_IHC2.jpg IHC (Immunohistochemistry) (Figure 2. IHC analysis of Sumo 1/SUMO1 using anti-Sumo 1/SUMO1 antibody (AAA19224).Sumo 1/SUMO1 was detected in paraffin-embedded section of mouse brain tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-Sumo 1/SUMO1 Antibody (AAA19224) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 1. IHC analysis of Sumo 1/SUMO1 using anti-Sumo 1/SUMO1 antibody (AAA19224).Sumo 1/SUMO1 was detected in paraffin-embedded section of mouse brain tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-Sumo 1/SUMO1 Antibody (AAA19224) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.)

product-image-AAA19224_IHC.jpg IHC (Immunohistochemistry) (Figure 1. IHC analysis of Sumo 1/SUMO1 using anti-Sumo 1/SUMO1 antibody (AAA19224).Sumo 1/SUMO1 was detected in paraffin-embedded section of mouse brain tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-Sumo 1/SUMO1 Antibody (AAA19224) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.)
Related Product Information for anti-SUMO1 antibody
Small ubiquitin-related modifier 1(SUMO1), also called SMT3C or PIC1 is a protein that in humans is encoded by the SUMO1 gene. This gene is mapped to 2q33. 1. This gene encodes a protein that is a member of the SUMO(small ubiquitin-like modifier) protein family. It functions in a manner similar to ubiquitin in that it is bound to target proteins as part of a post-translational modification system. However, unlike ubiquitin which targets proteins for degradation, this protein is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. It is not active until the last four amino acids of the carboxy-terminus have been cleaved off. Several pseudogenes have been reported for this gene.
References
1. Alkuraya, F. S., Saadi, I., Lund, J. L., Turbe-Doan, A., Morton, C. C., Maas, R. L. SUMO1 haploinsufficiency leads to cleft lip and palate. Science 313: 1751 only, 2006.
2. Kho, C., Lee, A., Jeong, D., Oh, J. G., Chaanine, A. H., Kizana, E., Park, W. J., Hajjar, R. J. SUMO1-dependent modulation of SERCA2a in heart failure. Nature 477: 601-605, 2011.
3. Martin, S., Nishimune, A., Mellor, J. R., Henley, J. M. SUMOylation regulates kainate-receptor-mediated synaptic transmission. Nature 447: 321-325, 2007.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11,557 Da
NCBI Official Full Name
small ubiquitin-related modifier 1 isoform a
NCBI Official Synonym Full Names
small ubiquitin-like modifier 1
NCBI Official Symbol
SUMO1
NCBI Official Synonym Symbols
DAP1; GMP1; PIC1; SMT3; UBL1; OFC10; SENP2; SMT3C; SMT3H3
NCBI Protein Information
small ubiquitin-related modifier 1; sentrin; SMT3 homolog 3; GAP modifying protein 1; ubiquitin-like protein UBL1; ubiquitin-like protein SMT3C; SMT3 suppressor of mif two 3 homolog 1; ubiquitin-homology domain protein PIC1
UniProt Protein Name
Small ubiquitin-related modifier 1
UniProt Gene Name
SUMO1
UniProt Synonym Gene Names
SMT3C; SMT3H3; UBL1; SUMO-1; GMP1; Smt3C
UniProt Entry Name
SUMO1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The SUMO1 sumo1 (Catalog #AAA19224) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-Sumo 1/SUMO1 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Sumo 1/SUMO1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), ICC (Immunocytochemistry), IF (Immunofluorescence), FCM/FACS (Flow Cytometry). IHC-P: 1-2ug/ml|Human, Mouse, Rat| ICC/IF: 5ug/ml|Human| FC/FACS/FCM: 1-3ug/1x106 cells|Mouse|. Researchers should empirically determine the suitability of the SUMO1 sumo1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Sumo 1/SUMO1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.