Loading...

Skip to main content

Call us at +1-800-604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

IF (Immunofluorescence) (Immunofluorescence analysis of U-2 OS cells using SUMO1 antibody (AAA28442) at dilution of 1:100. Blue: DAPI for nuclear staining.)

Rabbit SUMO1 Polyclonal Antibody | anti-SUMO1 antibody

[KO Validated] SUMO1 Rabbit pAb

Gene Names
SUMO1; DAP1; GMP1; PIC1; SMT3; UBL1; OFC10; SENP2; SMT3C; SMT3H3
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry, Immunofluorescence, Immunocytochemistry
Purity
Affinity purification
Synonyms
SUMO1, Antibody; [KO Validated] SUMO1 Rabbit pAb; DAP1; GMP1; PIC1; SMT3; UBL1; OFC10; SENP2; SMT3C; SMT3H3; anti-SUMO1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
Liquid
PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Sequence
MTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHST
Applicable Applications for anti-SUMO1 antibody
Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), Immunofluorescence (IF), Immunocytochemistry (ICC)
Application Notes
WB: 1:500-1:1000
IHC-P: 1:50-1:100
IF/ICC: 1:50-1:200
Positive Samples
293T
Cellular Location
Cell membrane, Cytoplasm, Nucleus, Nucleus membrane, Nucleus speckle, PML body
Research Area
Epigenetics Nuclear Signaling, RNA Binding, Cell Biology Developmental Biology, Autophagy, Ubiquitin, Endocrine Metabolism, Mitochondrial metabolism, Immunology Inflammation, Jak-Stat-IL-6 Receptor Signaling Pathway, NF-kB Signaling Pathway, Cardiovascular, Heart
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 40-100 of human SUMO1 (NP_003343.1).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Ship: Ice Pack

IF (Immunofluorescence)

(Immunofluorescence analysis of U-2 OS cells using SUMO1 antibody (AAA28442) at dilution of 1:100. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence) (Immunofluorescence analysis of U-2 OS cells using SUMO1 antibody (AAA28442) at dilution of 1:100. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of NIH-3T3 cells using SUMO1 antibody (AAA28442) at dilution of 1:100. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence) (Immunofluorescence analysis of NIH-3T3 cells using SUMO1 antibody (AAA28442) at dilution of 1:100. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of C6 cells using SUMO1 antibody (AAA28442) at dilution of 1:100. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence) (Immunofluorescence analysis of C6 cells using SUMO1 antibody (AAA28442) at dilution of 1:100. Blue: DAPI for nuclear staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded mouse testis using SUMO1 antibody (AAA28442) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded mouse testis using SUMO1 antibody (AAA28442) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded rat brain using SUMO1 antibody (AAA28442) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded rat brain using SUMO1 antibody (AAA28442) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded human lung cancer using SUMO1 antibody (AAA28442) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded human lung cancer using SUMO1 antibody (AAA28442) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

WB (Western Blot)

(Western blot analysis of extracts from wild type(WT) and SUMO1 Rabbit pAb knockout (KO) 293T cells, using SUMO1 Rabbit pAb antibody (AAA28442) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 180s.)

WB (Western Blot) (Western blot analysis of extracts from wild type(WT) and SUMO1 Rabbit pAb knockout (KO) 293T cells, using SUMO1 Rabbit pAb antibody (AAA28442) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 180s.)
Related Product Information for anti-SUMO1 antibody
This gene encodes a protein that is a member of the SUMO (small ubiquitin-like modifier) protein family. It functions in a manner similar to ubiquitin in that it is bound to target proteins as part of a post-translational modification system. However, unlike ubiquitin which targets proteins for degradation, this protein is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. It is not active until the last four amino acids of the carboxy-terminus have been cleaved off. Several pseudogenes have been reported for this gene. Alternate transcriptional splice variants encoding different isoforms have been characterized.
Product Categories/Family for anti-SUMO1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11,557 Da
NCBI Official Full Name
small ubiquitin-related modifier 1 isoform a
NCBI Official Synonym Full Names
small ubiquitin-like modifier 1
NCBI Official Symbol
SUMO1
NCBI Official Synonym Symbols
DAP1; GMP1; PIC1; SMT3; UBL1; OFC10; SENP2; SMT3C; SMT3H3
NCBI Protein Information
small ubiquitin-related modifier 1; sentrin; SMT3 homolog 3; GAP modifying protein 1; ubiquitin-like protein UBL1; ubiquitin-like protein SMT3C; SMT3 suppressor of mif two 3 homolog 1; ubiquitin-homology domain protein PIC1
UniProt Protein Name
Small ubiquitin-related modifier 1
UniProt Gene Name
SUMO1
UniProt Synonym Gene Names
SMT3C; SMT3H3; UBL1; SUMO-1; GMP1; Smt3C
UniProt Entry Name
SUMO1_HUMAN

Similar Products

Product Notes

The SUMO1 sumo1 (Catalog #AAA28442) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The [KO Validated] SUMO1 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SUMO1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), Immunofluorescence (IF), Immunocytochemistry (ICC). WB: 1:500-1:1000 IHC-P: 1:50-1:100 IF/ICC: 1:50-1:200. Researchers should empirically determine the suitability of the SUMO1 sumo1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MTTHLKKLKE SYCQRQGVPM NSLRFLFEGQ RIADNHTPKE LGMEEEDVIE VYQEQTGGHS T. It is sometimes possible for the material contained within the vial of "SUMO1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.