Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281691_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded rat pancreatic islet using SURF4 antibody at dilution of 1:200 (40x lens).)

Rabbit SURF4 Polyclonal Antibody | anti-SURF4 antibody

SURF4 Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
SURF4; ERV29
Reactivity
Human, Mouse, Rat
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
SURF4, Antibody; SURF4 Rabbit pAb; SURF4; ERV29; surfeit 4; anti-SURF4 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300,50% glycerol,pH7.3.
Sequence
ACFGLFGIIALQTIAYSILWDLKFLMRNLALGGGLLLLLAESRSEGKSMFAGVPTMRESSPKQYMQLGGRVLLVLMFMTLLHFDASFFSIVQNIVGTALMI
Applicable Applications for anti-SURF4 antibody
IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 50-150 of human SURF4 (NP_001267719.1).
Positive Samples
HepG2
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohistochemisry)

(Immunohistochemistry of paraffin-embedded rat pancreatic islet using SURF4 antibody at dilution of 1:200 (40x lens).)

product-image-AAA281691_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded rat pancreatic islet using SURF4 antibody at dilution of 1:200 (40x lens).)

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded human liver cancer using SURF4 antibody at dilution of 1:200 (40x lens).)

product-image-AAA281691_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded human liver cancer using SURF4 antibody at dilution of 1:200 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of HepG2 cells, using SURF4 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

product-image-AAA281691_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of HepG2 cells, using SURF4 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)
Related Product Information for anti-SURF4 antibody
Background: This gene is located in the surfeit gene cluster, which is comprised of very tightly linked housekeeping genes that do not share sequence similarity. The encoded protein is a conserved integral membrane protein that interacts with endoplasmic reticulum-Golgi intermediate compartment proteins. Disruption of this gene results in reduced numbers of endoplasmic reticulum-Golgi intermediate compartment clusters and redistribution of coat protein I to the cytosol. Alternate splicing results in multiple transcript variants.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17,970 Da
NCBI Official Full Name
surfeit locus protein 4 isoform 1
NCBI Official Synonym Full Names
surfeit 4
NCBI Official Symbol
SURF4
NCBI Official Synonym Symbols
ERV29
NCBI Protein Information
surfeit locus protein 4
UniProt Protein Name
Surfeit locus protein 4
UniProt Gene Name
SURF4
UniProt Synonym Gene Names
SURF-4

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The SURF4 surf4 (Catalog #AAA281691) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SURF4 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SURF4 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the SURF4 surf4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ACFGLFGIIA LQTIAYSILW DLKFLMRNLA LGGGLLLLLA ESRSEGKSMF AGVPTMRESS PKQYMQLGGR VLLVLMFMTL LHFDASFFSI VQNIVGTALM I. It is sometimes possible for the material contained within the vial of "SURF4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.