Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46848_IHC13.jpg IHC (Immunohiostchemistry) (Synapsin I was detected in paraffin-embedded sections of human glioma tissues using rabbit anti- Synapsin I Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method.)

Rabbit Synapsin I Polyclonal Antibody | anti-SYN1 antibody

Anti-Synapsin I Antibody

Average rating 0.0
No ratings yet
Gene Names
SYN1; SYNI; SYN1a; SYN1b
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen affinity purified.
Synonyms
Synapsin I, Antibody; Anti-Synapsin I Antibody; SYN 1; SYN 1a; SYN1a; SYN 1b; SYN1b; SYN I; SYNI; Synapsin1; Synapsin-1; Synapsin 1; P17600; synapsin I; anti-SYN1 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
705
Applicable Applications for anti-SYN1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Notes
Tested Species: In-house tested species with positive results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Synapsin I (662-705aa KSQSLTNAFNLPEPAPPRPSLSQDEVKAETIRSLRKSFASL FSD), identical to the related mouse and rat sequences.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohiostchemistry)

(Synapsin I was detected in paraffin-embedded sections of human glioma tissues using rabbit anti- Synapsin I Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46848_IHC13.jpg IHC (Immunohiostchemistry) (Synapsin I was detected in paraffin-embedded sections of human glioma tissues using rabbit anti- Synapsin I Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method.)

WB (Western Blot)

(Western blot analysis of Synapsin I expression in rat brain extract (lane 1), mouse brain extract (lane 2), and SHG-44 whole cell lysates (lane 3). Synapsin I at 78KD was detected using rabbit anti- Synapsin I Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.)

product-image-AAA46848_WB15.jpg WB (Western Blot) (Western blot analysis of Synapsin I expression in rat brain extract (lane 1), mouse brain extract (lane 2), and SHG-44 whole cell lysates (lane 3). Synapsin I at 78KD was detected using rabbit anti- Synapsin I Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.)
Related Product Information for anti-SYN1 antibody
Rabbit IgG polyclonal antibody for Synapsin-1(SYN1) detection.
Background: Synapsin I, is the collective name for Synapsin Ia and Synapsin Ib, two nearly identical phosphoproteins that in humans are encoded by the SYN1 gene. This gene is a member of the synapsin gene family. Synapsins encode neuronal phosphoproteins which associate with the cytoplasmic surface of synaptic vesicles. Family members are characterized by common protein domains, and they are implicated in synaptogenesis and the modulation of neurotransmitter release, suggesting a potential role in several neuropsychiatric diseases. This member of the synapsin family plays a role in regulation of axonogenesis and synaptogenesis. The protein encoded serves as a substrate for several different protein kinases and phosphorylation may function in the regulation of this protein in the nerve terminal. Mutations in this gene may be associated with X-linked disorders with primary neuronal degeneration such as Rett syndrome. Alternatively spliced transcript variants encoding different isoforms have been identified.
References
1. "Entrez Gene: SYN1 synapsin I".
2. Huttner WB, Schiebler W, Greengard P, De Camilli P (May 1983). "Synapsin I (protein I), a nerve terminal-specific phosphoprotein. III. Its association with synaptic vesicles studied in a highly purified synaptic vesicle preparation". J. Cell Biol. 96 (5): 1374-88.
3. Südhof TC (May 1990). "The structure of the human synapsin I gene and protein". J. Biol. Chem. 265 (14): 7849-52.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
70,033 Da
NCBI Official Full Name
synapsin-1 isoform Ia
NCBI Official Synonym Full Names
synapsin I
NCBI Official Symbol
SYN1
NCBI Official Synonym Symbols
SYNI; SYN1a; SYN1b
NCBI Protein Information
synapsin-1
UniProt Protein Name
Synapsin-1
UniProt Gene Name
SYN1

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The SYN1 syn1 (Catalog #AAA46848) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-Synapsin I Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Synapsin I can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the SYN1 syn1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Synapsin I, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.