Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281766_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of L929 cells using SYT12 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Rabbit anti-Mouse SYT12 Polyclonal Antibody | anti-SYT12 antibody

SYT12 Rabbit pAb

Gene Names
SYT12; SYT11; sytXII
Reactivity
Mouse
Applications
Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
SYT12, Antibody; SYT12 Rabbit pAb; SYT12; SYT11; sytXII; anti-SYT12 antibody
Ordering
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
KGSLSIEDTFESISELGPLELMGRELDLAPYGTLRKSQSADSLNSISSVSNTFGQDFTLGQVEVSMEYDTASHTLNVAVMQGKDLLEREEASFESCFMRVSLLPDE
Applicable Applications for anti-SYT12 antibody
IF (Immunofluorescence), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 95-200 of human SYT12 (NP_001171351.1).
Positive Samples
Mouse brain
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of L929 cells using SYT12 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA281766_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of L929 cells using SYT12 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of extracts of Mouse brain, using SYT12 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3min.)

product-image-AAA281766_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of Mouse brain, using SYT12 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3min.)
Related Product Information for anti-SYT12 antibody
Background: This gene is a member of the synaptotagmin gene family and encodes a protein similar to other family members that mediate calcium-dependent regulation of membrane trafficking in synaptic transmission. Studies of the orthologous gene in rat have shown that the encoded protein selectively modulates spontaneous synaptic-vesicle exocytosis and may also be involved in regulating calcium independent secretion in nonneuronal cells. Alternative splicing results in multiple transcript variants. The gene has previously been referred to as synaptotagmin XI but has been renamed synaptotagmin XII to be standard with mouse and rat official nomenclature.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46,537 Da
NCBI Official Full Name
synaptotagmin-12
NCBI Official Synonym Full Names
synaptotagmin XII
NCBI Official Symbol
SYT12
NCBI Official Synonym Symbols
SYT11; sytXII
NCBI Protein Information
synaptotagmin-12; synaptotagmin-XII
UniProt Protein Name
Synaptotagmin-12
UniProt Gene Name
SYT12
UniProt Synonym Gene Names
SytXII
UniProt Entry Name
SYT12_HUMAN

Similar Products

Product Notes

The SYT12 syt12 (Catalog #AAA281766) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SYT12 Rabbit pAb reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's SYT12 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the SYT12 syt12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: KGSLSIEDTF ESISELGPLE LMGRELDLAP YGTLRKSQSA DSLNSISSVS NTFGQDFTLG QVEVSMEYDT ASHTLNVAVM QGKDLLEREE ASFESCFMRV SLLPDE. It is sometimes possible for the material contained within the vial of "SYT12, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.