Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201338_WB11.jpg WB (Western Blot) (WB Suggested Anti-TAAR6 AntibodyTitration: 1.0 ug/mlPositive Control: A549 Whole Cell)

Rabbit TAAR6 Polyclonal Antibody | anti-TAAR6 antibody

TAAR6 Antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
TAAR6; TA4; TAR4; TAR6; TRAR4; taR-4; taR-6
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
TAAR6, Antibody; TAAR6 Antibody - C-terminal region; anti-TAAR6 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YGNIFLVARRQAKKIENTGSKTESSSESYKARVARRERKAAKTLGVTVVA
Sequence Length
345
Applicable Applications for anti-TAAR6 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 93%; Dog: 92%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human TAAR6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-TAAR6 AntibodyTitration: 1.0 ug/mlPositive Control: A549 Whole Cell)

product-image-AAA201338_WB11.jpg WB (Western Blot) (WB Suggested Anti-TAAR6 AntibodyTitration: 1.0 ug/mlPositive Control: A549 Whole Cell)

IHC (Immunohiostchemistry)

(Researcher:Timur Mavlyutov, Ph. D., University of Wisconsin Medical SchoolApplication: IHCSpecies+tissue/cell type:Rhesus macaque spinal cordPrimary antibody dilution: 1:300Secondary antibody: Donkey anti Rabbit 488Secondary antibody dilution: 1:500)

product-image-AAA201338_IHC13.jpg IHC (Immunohiostchemistry) (Researcher:Timur Mavlyutov, Ph. D., University of Wisconsin Medical SchoolApplication: IHCSpecies+tissue/cell type:Rhesus macaque spinal cordPrimary antibody dilution: 1:300Secondary antibody: Donkey anti Rabbit 488Secondary antibody dilution: 1:500)

IHC (Immunohistochemistry)

(Researcher: Timur Mavlyutov, University of Wisconsin Medical SchoolApplication: IHCSpecies+tissue/cell type: Ventral horn region of mouse spinal cordPrimary antibody dilution: 1:200Secondary antibody: Donkey anti-rabbit CY2Secondary antibody dilution:1:500)

product-image-AAA201338_IHC15.jpg IHC (Immunohistochemistry) (Researcher: Timur Mavlyutov, University of Wisconsin Medical SchoolApplication: IHCSpecies+tissue/cell type: Ventral horn region of mouse spinal cordPrimary antibody dilution: 1:200Secondary antibody: Donkey anti-rabbit CY2Secondary antibody dilution:1:500)
Related Product Information for anti-TAAR6 antibody
This is a rabbit polyclonal antibody against TAAR6. It was validated on Western Blot

Target Description: This gene encodes a seven-transmembrane G-protein-coupled receptor that likely functions as a receptor for endogenous trace amines. Mutations in this gene may be associated with schizophrenia.
Product Categories/Family for anti-TAAR6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
trace amine-associated receptor 6
NCBI Official Synonym Full Names
trace amine associated receptor 6
NCBI Official Symbol
TAAR6
NCBI Official Synonym Symbols
TA4; TAR4; TAR6; TRAR4; taR-4; taR-6
NCBI Protein Information
trace amine-associated receptor 6
UniProt Protein Name
Trace amine-associated receptor 6
UniProt Gene Name
TAAR6
UniProt Synonym Gene Names
TA4; TAR4; TRAR4; TaR-6; Trace amine receptor 6; TaR-4
UniProt Entry Name
TAAR6_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The TAAR6 taar6 (Catalog #AAA201338) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TAAR6 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's TAAR6 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the TAAR6 taar6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YGNIFLVARR QAKKIENTGS KTESSSESYK ARVARRERKA AKTLGVTVVA. It is sometimes possible for the material contained within the vial of "TAAR6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.