Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201757_WB13.jpg WB (Western Blot) (WB Suggested Anti-TAF1A Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)

Rabbit TAF1A Polyclonal Antibody | anti-TAF1A antibody

TAF1A antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
TAF1A; SL1; RAFI48; TAFI48; MGC:17061
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Synonyms
TAF1A, Antibody; TAF1A antibody - C-terminal region; anti-TAF1A antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CEKAFVAGLLLGKGCRYFRYILKQDHQILGKKIKRMKRSVKKYSIVNPRL
Sequence Length
336
Applicable Applications for anti-TAF1A antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 78%; Dog: 85%; Horse: 85%; Human: 100%; Mouse: 85%; Pig: 85%; Rabbit: 85%; Rat: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human TAF1A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-TAF1A Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)

product-image-AAA201757_WB13.jpg WB (Western Blot) (WB Suggested Anti-TAF1A Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)

IHC (Immunohistochemistry)

(Human Heart)

product-image-AAA201757_IHC15.jpg IHC (Immunohistochemistry) (Human Heart)
Related Product Information for anti-TAF1A antibody
This is a rabbit polyclonal antibody against TAF1A. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Initiation of transcription by RNA polymerase I requires the formation of a complex composed of the TATA-binding protein (TBP) and three TBP-associated factors (TAFs) specific for RNA polymerase I. This complex, known as SL1, binds to the core promoter of ribosomal RNA genes to position the polymerase properly and acts as a channel for regulatory signals. TAF1A encodes the smallest SL1-specific TAF.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
TATA box-binding protein-associated factor RNA polymerase I subunit A isoform 2
NCBI Official Synonym Full Names
TATA-box binding protein associated factor, RNA polymerase I subunit A
NCBI Official Symbol
TAF1A
NCBI Official Synonym Symbols
SL1; RAFI48; TAFI48; MGC:17061
NCBI Protein Information
TATA box-binding protein-associated factor RNA polymerase I subunit A

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The TAF1A (Catalog #AAA201757) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TAF1A antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TAF1A can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the TAF1A for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CEKAFVAGLL LGKGCRYFRY ILKQDHQILG KKIKRMKRSV KKYSIVNPRL. It is sometimes possible for the material contained within the vial of "TAF1A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.