WB (Western Blot)
(WB Suggested Anti-TAF9 Antibody Titration: 0.125ug/mlELISA Titer: 1:312500Positive Control: Human Small Intestine)
Rabbit TAF9 Polyclonal Antibody | anti-TAF9 antibody
TAF9 antibody - N-terminal region
Gene Names
AK6; CIP; CINAP; AD-004; hCINAP; CGI-137
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Chromatin Immunoprecipitation, Immunoprecipitation, Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
TAF9, Antibody; TAF9 antibody - N-terminal region; anti-TAF9 antibody
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVD
Sequence Length
169
Applicable Applications for anti-TAF9 antibody
ChIP (Chromatin immunoprecipitation), WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 93%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 79%; Rat: 90%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TAF9
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-TAF9 Antibody Titration: 0.125ug/mlELISA Titer: 1:312500Positive Control: Human Small Intestine)
WB (Western Blot)
(WB Suggested Anti-TAF9 Antibody Titration: 0.125ug/mlELISA Titer: 1:312500Positive Control: Human Small Intestine)
IHC (Immunohiostchemistry)
(Human Skin)
IHC (Immunohiostchemistry)
(Human Skin)
ChIP (Chromatin Immunoprecipitation)
(Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.)
ChIP (Chromatin Immunoprecipitation)
(Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.)
Related Product Information for anti-TAF9 antibody
This is a rabbit polyclonal antibody against TAF9. It was validated on Western Blot and immunohistochemistry
Target Description: Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes one of the smaller subunits of TFIID that binds to the basal transcription factor GTF2B as well as to several transcriptional activators such as p53 and VP16.
Target Description: Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes one of the smaller subunits of TFIID that binds to the basal transcription factor GTF2B as well as to several transcriptional activators such as p53 and VP16.
Product Categories/Family for anti-TAF9 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19kDa
NCBI Official Full Name
adenylate kinase isoenzyme 6 isoform c
NCBI Official Synonym Full Names
adenylate kinase 6
NCBI Official Symbol
AK6
NCBI Official Synonym Symbols
CIP; CINAP; AD-004; hCINAP; CGI-137
NCBI Protein Information
adenylate kinase isoenzyme 6
UniProt Protein Name
Adenylate kinase isoenzyme 6
UniProt Gene Name
TAF9
UniProt Synonym Gene Names
AK6; CINAP; AK6; hCINAP; AK/ATPase
UniProt Entry Name
KAD6_HUMAN
Similar Products
Product Notes
The TAF9 taf9 (Catalog #AAA197833) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TAF9 antibody - N-terminal region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TAF9 can be used in a range of immunoassay formats including, but not limited to, ChIP (Chromatin immunoprecipitation), WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the TAF9 taf9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GLKYINVGDL AREEQLYDGY DEEYDCPILD EDRVVDELDN QMREGGVIVD. It is sometimes possible for the material contained within the vial of "TAF9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.