Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46627_IHC10.jpg IHC (Immunohistochemistry) (Talin 2 was detected in paraffin-embedded sections of human intestinal cancer tissues using rabbit anti- Talin 2 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

Rabbit Talin 2 Polyclonal Antibody | anti-TLN2 antibody

Anti-Talin 2 Antibody

Average rating 0.0
No ratings yet
Gene Names
TLN2; ILWEQ
Reactivity
Human, Mouse, Rat
No cross reactivity with other proteins.
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen affinity purified.
Synonyms
Talin 2, Antibody; Anti-Talin 2 Antibody; Talin2; Talin 2; Talin-2; TLN2; TLN 2; TLN-2; ILWEQ; Q9Y4G6; talin 2; anti-TLN2 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
No cross reactivity with other proteins.
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Sequence Length
2542
Applicable Applications for anti-TLN2 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human Talin 2 (1787-1822aa NPKAQHTHDAITEAAQLMKEAVDDIMVTLNEAASEV).
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemistry)

(Talin 2 was detected in paraffin-embedded sections of human intestinal cancer tissues using rabbit anti- Talin 2 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46627_IHC10.jpg IHC (Immunohistochemistry) (Talin 2 was detected in paraffin-embedded sections of human intestinal cancer tissues using rabbit anti- Talin 2 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

IHC (Immunohistochemisry)

(Talin 2 was detected in paraffin-embedded sections of rat intestine tissues using rabbit anti- Talin 2 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46627_IHC11.jpg IHC (Immunohistochemisry) (Talin 2 was detected in paraffin-embedded sections of rat intestine tissues using rabbit anti- Talin 2 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

IHC (Immunohiostchemistry)

(Talin 2 was detected in paraffin-embedded sections of mouse intestine tissues using rabbit anti- Talin 2 Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46627_IHC13.jpg IHC (Immunohiostchemistry) (Talin 2 was detected in paraffin-embedded sections of mouse intestine tissues using rabbit anti- Talin 2 Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method.)

WB (Western Blot)

(Western blot analysis of Talin 2 expression in rat brain extract (lane 1), mouse cardiac muscle extract (lane 2) and SMMC7721 whole cell lysates (lane 3). Talin 2 at 271KD was detected using rabbit anti-Talin 2 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.)

product-image-AAA46627_WB15.jpg WB (Western Blot) (Western blot analysis of Talin 2 expression in rat brain extract (lane 1), mouse cardiac muscle extract (lane 2) and SMMC7721 whole cell lysates (lane 3). Talin 2 at 271KD was detected using rabbit anti-Talin 2 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.)
Related Product Information for anti-TLN2 antibody
Rabbit IgG polyclonal antibody for Talin-2 (TLN2) detection.
Background: Talin 2 is a protein in humans that is encoded by the TLN2 gene. It belongs to the talin protein family. This gene encodes a protein related to talin 1, a cytoskeletal protein that plays a significant role in the assembly of actin filaments and in spreading and migration of various cell types, including fibroblasts and osteoclasts. Talin-2 is expressed at high levels in cardiac muscle and functions to provide linkages between the extracellular matrix and actin cytoskeleton at costamere structures to transduce force laterally.
References
1. "Entrez Gene: Talin 2".
2. Monkley SJ, Pritchard CA, Critchley DR (Sep 2001). "Analysis of the mammalian talin2 gene TLN2". Biochemical and Biophysical Research Communications 286 (5): 880-5.
3. Praekelt U, Kopp PM, Rehm K, Linder S, Bate N, Patel B, Debrand E, Manso AM, Ross RS, Conti F, Zhang MZ, Harris RC, Zent R, Critchley DR, Monkley SJ (Mar 2012). "New isoform-specific monoclonal antibodies reveal different sub-cellular localisations for talin1 and talin2". European Journal of Cell Biology 91 (3): 180-91.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
271,613 Da
NCBI Official Full Name
talin-2
NCBI Official Synonym Full Names
talin 2
NCBI Official Symbol
TLN2
NCBI Official Synonym Symbols
ILWEQ
NCBI Protein Information
talin-2
UniProt Protein Name
Talin-2
UniProt Gene Name
TLN2
UniProt Synonym Gene Names
KIAA0320
UniProt Entry Name
TLN2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The TLN2 tln2 (Catalog #AAA46627) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-Talin 2 Antibody reacts with Human, Mouse, Rat No cross reactivity with other proteins. and may cross-react with other species as described in the data sheet. AAA Biotech's Talin 2 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the TLN2 tln2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Talin 2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.