Rabbit TAS2R13 Polyclonal Antibody | anti-TAS2R13 antibody
TAS2R13 Antibody - middle region
Gene Names
TAS2R13; TRB3; T2R13
Reactivity
Tested/Predicted Reactivity: Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TAS2R13, Antibody; TAS2R13 Antibody - middle region; anti-TAS2R13 antibody
Host
Rabbit
Reactivity
Tested/Predicted Reactivity: Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5mg/mL (varies by lot)
Sequence
Synthetic peptide located within the following region: HIKDWLDRYERNTTWNFSMSDFETFSVSVKFTMTMFSLTPFTVAFISFLL
Sequence Length
303
Applicable Applications for anti-TAS2R13 antibody
WB (Western Blot)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human TAS2R13
Protein size (#AA)
303 amino acids
Blocking Peptide
For anti-TAS2R13 (MBS3218954) antibody is Catalog #
Protein Interactions
FZR1; UBC; CDC20;
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-TAS2R13 antibody
Target Description: This gene product belongs to the family of candidate taste receptors that are members of the G-protein-coupled receptor superfamily. These proteins are specifically expressed in the taste receptor cells of the tongue and palate epithelia. They are organized in the genome in clusters and are genetically linked to loci that influence bitter perception in mice and humans. In functional expression studies, they respond to bitter tastants. This gene maps to the taste receptor gene cluster on chromosome 12p13.
Product Categories/Family for anti-TAS2R13 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33kDa
NCBI Official Full Name
taste receptor type 2 member 13
NCBI Official Synonym Full Names
taste 2 receptor member 13
NCBI Official Symbol
TAS2R13
NCBI Official Synonym Symbols
TRB3; T2R13
NCBI Protein Information
taste receptor type 2 member 13
UniProt Protein Name
Taste receptor type 2 member 13
UniProt Gene Name
TAS2R13
UniProt Synonym Gene Names
T2R13; TRB3
UniProt Entry Name
T2R13_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The TAS2R13 tas2r13 (Catalog #AAA201468) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TAS2R13 Antibody - middle region reacts with Tested/Predicted Reactivity: Human and may cross-react with other species as described in the data sheet. AAA Biotech's TAS2R13 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the TAS2R13 tas2r13 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HIKDWLDRYE RNTTWNFSMS DFETFSVSVK FTMTMFSLTP FTVAFISFLL. It is sometimes possible for the material contained within the vial of "TAS2R13, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
