WB (Western Blot)
(WB Suggested Anti-TAZ AntibodyTitration: 1.0 ug/mlPositive Control: Placenta)
Rabbit TAZ Polyclonal Antibody | anti-TAZ antibody
TAZ Antibody - C-terminal region
Gene Names
TAZ; EFE; BTHS; EFE2; G4.5; Taz1; CMD3A; LVNCX
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TAZ, Antibody; TAZ Antibody - C-terminal region; anti-TAZ antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQ
Sequence Length
248
Applicable Applications for anti-TAZ antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of TAZ
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-TAZ AntibodyTitration: 1.0 ug/mlPositive Control: Placenta)
WB (Western Blot)
(WB Suggested Anti-TAZ AntibodyTitration: 1.0 ug/mlPositive Control: Placenta)
WB (Western Blot)
(Lanes:Lane 1: 20ug mouse cardiac mitochondria lysateLane 2: 20ug mouse cardiac mitochondria lysateLane 3: 20ug mouse cardiac mitochondria lysateLane 4: 20ug mouse cardiac mitochondria lysatePrimary Antibody Dilution:1:500Secondary Antibody:Goat anti-rabbit-HRPSecondary Antibody Dilution:1:2500Gene Name:TAZ AnSubmitted by:Corey Powers, Cincinati Children's Hospital Medical Center)
WB (Western Blot)
(Lanes:Lane 1: 20ug mouse cardiac mitochondria lysateLane 2: 20ug mouse cardiac mitochondria lysateLane 3: 20ug mouse cardiac mitochondria lysateLane 4: 20ug mouse cardiac mitochondria lysatePrimary Antibody Dilution:1:500Secondary Antibody:Goat anti-rabbit-HRPSecondary Antibody Dilution:1:2500Gene Name:TAZ AnSubmitted by:Corey Powers, Cincinati Children's Hospital Medical Center)
Related Product Information for anti-TAZ antibody
This is a rabbit polyclonal antibody against TAZ. It was validated on Western Blot
Target Description: This gene encodes a protein that is expressed at high levels in cardiac and skeletal muscle. Mutations in this gene have been associated with a number of clinical disorders including Barth syndrome, dilated cardiomyopathy (DCM), hypertrophic DCM, endocardial fibroelastosis, and left ventricular noncompaction (LVNC). Multiple transcript variants encoding different isoforms have been described. A long form and a short form of each of these isoforms is produced; the short form lacks a hydrophobic leader sequence and may exist as a cytoplasmic protein rather than being membrane-bound. Other alternatively spliced transcripts have been described but the full-length nature of all these transcripts is not known.
Target Description: This gene encodes a protein that is expressed at high levels in cardiac and skeletal muscle. Mutations in this gene have been associated with a number of clinical disorders including Barth syndrome, dilated cardiomyopathy (DCM), hypertrophic DCM, endocardial fibroelastosis, and left ventricular noncompaction (LVNC). Multiple transcript variants encoding different isoforms have been described. A long form and a short form of each of these isoforms is produced; the short form lacks a hydrophobic leader sequence and may exist as a cytoplasmic protein rather than being membrane-bound. Other alternatively spliced transcripts have been described but the full-length nature of all these transcripts is not known.
Product Categories/Family for anti-TAZ antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
tafazzin isoform 1
NCBI Official Synonym Full Names
tafazzin
NCBI Official Symbol
TAZ
NCBI Official Synonym Symbols
EFE; BTHS; EFE2; G4.5; Taz1; CMD3A; LVNCX
NCBI Protein Information
tafazzin
UniProt Protein Name
Tafazzin
UniProt Gene Name
TAZ
UniProt Synonym Gene Names
EFE2; G4.5
UniProt Entry Name
TAZ_HUMAN
Similar Products
Product Notes
The TAZ taz (Catalog #AAA201191) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TAZ Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TAZ can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the TAZ taz for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PNSPPYFPRF GQKITVLIGK PFSALPVLER LRAENKSAVE MRKALTDFIQ. It is sometimes possible for the material contained within the vial of "TAZ, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.