Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281470_IF11.jpg IF (Immunofluorescence) (Immunofluorescence-TBP Polyclonal Antibody)

Rabbit TBP Polyclonal Antibody | anti-TBP antibody

TBP Polyclonal Antibody

Average rating 0.0
No ratings yet
Gene Names
TBP; HDL4; GTF2D; SCA17; TFIID; GTF2D1
Reactivity
Human, Mouse, Rat
Applications
Immunofluorescence, Western Blot
Purity
Affinity Purification
Synonyms
TBP, Antibody; TBP Polyclonal Antibody; TBP; GTF2D; GTF2D1; HDL4; SCA17; TFIID; TATA-box-binding protein; anti-TBP antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
1.69 mg/ml (varies by lot)
Sequence Length
319
Applicable Applications for anti-TBP antibody
IF (Immunofluorescence), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 160-319 of human TBP (NP_001165556.1).
Immunogen Sequence
LKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRKTT
Cellular Location
Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence-TBP Polyclonal Antibody)

product-image-AAA281470_IF11.jpg IF (Immunofluorescence) (Immunofluorescence-TBP Polyclonal Antibody)

IF (Immunofluorescence)

(Immunofluorescence-TBP Polyclonal Antibody)

product-image-AAA281470_IF13.jpg IF (Immunofluorescence) (Immunofluorescence-TBP Polyclonal Antibody)

IF (Immunofluorescence)

(Immunofluorescence-TBP Polyclonal Antibody)

product-image-AAA281470_IF15.jpg IF (Immunofluorescence) (Immunofluorescence-TBP Polyclonal Antibody)
Related Product Information for anti-TBP antibody
Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes TBP, the TATA-binding protein. A distinctive feature of TBP is a long string of glutamines in the N-terminus. This region of the protein modulates the DNA binding activity of the C terminus, and modulation of DNA binding affects the rate of transcription complex formation and initiation of transcription. The number of CAG repeats encoding the polyglutamine tract is usually 25-42, and expansion of the number of repeats to 45-66 increases the length of the polyglutamine string and is associated with spinocerebellar ataxia 17, a neurodegenerative disorder classified as a polyglutamine disease. Two transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa; 37kDa
NCBI Official Full Name
TATA-box-binding protein isoform 2
NCBI Official Synonym Full Names
TATA-box binding protein
NCBI Official Symbol
TBP
NCBI Official Synonym Symbols
HDL4; GTF2D; SCA17; TFIID; GTF2D1
NCBI Protein Information
TATA-box-binding protein
UniProt Protein Name
TATA-box-binding protein
UniProt Gene Name
TBP
UniProt Synonym Gene Names
GTF2D1; TF2D; TFIID
UniProt Entry Name
TBP_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The TBP tbp (Catalog #AAA281470) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TBP Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TBP can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the TBP tbp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TBP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.