Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197260_WB11.jpg WB (Western Blot) (WB Suggested Anti-TBX10 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Muscle)

Rabbit TBX10 Polyclonal Antibody | anti-TBX10 antibody

TBX10 antibody - N-terminal region

Gene Names
TBX10; TBX7; TBX13
Reactivity
Cow, Horse, Human, Mouse, Pig, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
TBX10, Antibody; TBX10 antibody - N-terminal region; anti-TBX10 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Horse, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TSSTGAQAVAEPTGQGPKNPRVSRVTVQLEMKPLWEEFNQLGTEMIVTKA
Sequence Length
385
Applicable Applications for anti-TBX10 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 86%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TBX10
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-TBX10 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Muscle)

product-image-AAA197260_WB11.jpg WB (Western Blot) (WB Suggested Anti-TBX10 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Muscle)

WB (Western Blot)

(Host: MouseTarget Name: TBX10Sample Tissue: Mouse Skeletal MuscleAntibody Dilution: 1ug/ml)

product-image-AAA197260_WB13.jpg WB (Western Blot) (Host: MouseTarget Name: TBX10Sample Tissue: Mouse Skeletal MuscleAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-TBX10 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult LiverObserved Staining: Nuclear in hepatocytes, strong signal, wide tissue distributionPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)

product-image-AAA197260_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-TBX10 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult LiverObserved Staining: Nuclear in hepatocytes, strong signal, wide tissue distributionPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)
Related Product Information for anti-TBX10 antibody
This is a rabbit polyclonal antibody against TBX10. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TBX10, a member of the Tbx1-subfamily of conserved developmental genes, is located at human chromosome 11q13 and proximal mouse chromosome 19.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
T-box transcription factor TBX10
NCBI Official Synonym Full Names
T-box 10
NCBI Official Symbol
TBX10
NCBI Official Synonym Symbols
TBX7; TBX13
NCBI Protein Information
T-box transcription factor TBX10
UniProt Protein Name
T-box transcription factor TBX10
UniProt Gene Name
TBX10
UniProt Synonym Gene Names
TBX7; T-box protein 10
UniProt Entry Name
TBX10_HUMAN

Similar Products

Product Notes

The TBX10 tbx10 (Catalog #AAA197260) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TBX10 antibody - N-terminal region reacts with Cow, Horse, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TBX10 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the TBX10 tbx10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TSSTGAQAVA EPTGQGPKNP RVSRVTVQLE MKPLWEEFNQ LGTEMIVTKA. It is sometimes possible for the material contained within the vial of "TBX10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.