Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198018_WB13.jpg WB (Western Blot) (WB Suggested Anti-TCEAL1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Placenta)

Rabbit TCEAL1 Polyclonal Antibody | anti-TCEAL1 antibody

TCEAL1 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
TCEAL1; p21; SIIR; WEX9; pp21
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
TCEAL1, Antibody; TCEAL1 antibody - middle region; anti-TCEAL1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EGLSRKDLFEGRPPMEQPPCGVGKHKLEEGSFKERLARSRPQFRGDIHGR
Sequence Length
159
Applicable Applications for anti-TCEAL1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 87%; Dog: 87%; Horse: 87%; Human: 87%; Mouse: 87%; Pig: 87%; Rabbit: 87%; Rat: 80%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TCEAL1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-TCEAL1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Placenta)

product-image-AAA198018_WB13.jpg WB (Western Blot) (WB Suggested Anti-TCEAL1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Placenta)

IHC (Immunohistochemistry)

(Rabbit Anti-TCEAL1 antibodyParaffin Embedded Tissue: Human Heart cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA198018_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-TCEAL1 antibodyParaffin Embedded Tissue: Human Heart cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-TCEAL1 antibody
This is a rabbit polyclonal antibody against TCEAL1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TCEAL1 is a member of the transcription elongation factor A (SII)-like (TCEAL) protein family. Members of this family may function as nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner. TCEAL1 is similar to transcription elongation factor A/transcription factor SII and contains a zinc finger-like motif as well as a sequence related to the transcription factor SII Pol II-binding region. It may exert its effects via protein-protein interactions with other transcriptional regulators rather than via direct binding of DNA. This gene encodes a member of the transcription elongation factor A (SII)-like (TCEAL) gene family. Members of this family may function as nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner. The encoded protein is similar to transcription elongation factor A/transcription factor SII and contains a zinc finger-like motif as well as a sequence related to the transcription factor SII Pol II-binding region. It may exert its effects via protein-protein interactions with other transcriptional regulators rather than via direct binding of DNA. Multiple family members are located on the X chromosome. Alternative splicing results in multiple transcript variants encoding a single isoform.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19kDa
NCBI Official Full Name
transcription elongation factor A protein-like 1
NCBI Official Synonym Full Names
transcription elongation factor A like 1
NCBI Official Symbol
TCEAL1
NCBI Official Synonym Symbols
p21; SIIR; WEX9; pp21
NCBI Protein Information
transcription elongation factor A protein-like 1
UniProt Protein Name
Transcription elongation factor A protein-like 1
UniProt Gene Name
TCEAL1
UniProt Synonym Gene Names
SIIR; TCEA-like protein 1
UniProt Entry Name
TCAL1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The TCEAL1 tceal1 (Catalog #AAA198018) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TCEAL1 antibody - middle region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TCEAL1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the TCEAL1 tceal1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EGLSRKDLFE GRPPMEQPPC GVGKHKLEEG SFKERLARSR PQFRGDIHGR. It is sometimes possible for the material contained within the vial of "TCEAL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.