Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198367_WB13.jpg WB (Western Blot) (WB Suggested Anti-TCF20 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: OVCAR-3 cell lysateTCF20 is supported by BioGPS gene expression data to be expressed in OVCAR3)

Rabbit TCF20 Polyclonal Antibody | anti-TCF20 antibody

TCF20 Antibody - C-terminal region

Gene Names
TCF20; AR1; SPBP; TCF-20
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
TCF20, Antibody; TCF20 Antibody - C-terminal region; anti-TCF20 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HYPCAIDADCLLHEENFSVRCPKHKPPLPCPLPPLQNKTAKGSLSTEQSE
Sequence Length
1960
Applicable Applications for anti-TCF20 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human TCF20
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-TCF20 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: OVCAR-3 cell lysateTCF20 is supported by BioGPS gene expression data to be expressed in OVCAR3)

product-image-AAA198367_WB13.jpg WB (Western Blot) (WB Suggested Anti-TCF20 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: OVCAR-3 cell lysateTCF20 is supported by BioGPS gene expression data to be expressed in OVCAR3)

IHC (Immunohistochemistry)

(Rabbit Anti-TCF20 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult heartObserved Staining: Nuclear (nuclear membrane)Primary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)

product-image-AAA198367_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-TCF20 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult heartObserved Staining: Nuclear (nuclear membrane)Primary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)
Related Product Information for anti-TCF20 antibody
This is a rabbit polyclonal antibody against TCF20. It was validated on Western Blot

Target Description: This gene encodes a transcription factor that recognizes the platelet-derived growth factor-responsive element in the matrix metalloproteinase 3 promoter. The encoded protein is thought to be a transcriptional coactivator, enhancing the activity of transcription factors such as JUN and SP1. Mutations in this gene are associated with autism spectrum disorders. Alternative splicing results in multiple transcript variants.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
212kDa
NCBI Official Full Name
transcription factor 20 isoform 1
NCBI Official Synonym Full Names
transcription factor 20
NCBI Official Symbol
TCF20
NCBI Official Synonym Symbols
AR1; SPBP; TCF-20
NCBI Protein Information
transcription factor 20
UniProt Protein Name
Transcription factor 20
UniProt Gene Name
TCF20
UniProt Synonym Gene Names
KIAA0292; SPBP; TCF-20
UniProt Entry Name
TCF20_HUMAN

Similar Products

Product Notes

The TCF20 tcf20 (Catalog #AAA198367) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TCF20 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TCF20 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the TCF20 tcf20 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HYPCAIDADC LLHEENFSVR CPKHKPPLPC PLPPLQNKTA KGSLSTEQSE. It is sometimes possible for the material contained within the vial of "TCF20, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.