Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199604_WB8.jpg WB (Western Blot) (WB Suggested Anti-TDO2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Fetal Heart)

Rabbit TDO2 Polyclonal Antibody | anti-TDO2 antibody

TDO2 antibody - N-terminal region

Gene Names
TDO2; TO; TDO; TPH2; TRPO; HYPTRP
Reactivity
Dog, Human, Pig
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
TDO2, Antibody; TDO2 antibody - N-terminal region; anti-TDO2 antibody
Ordering
Host
Rabbit
Reactivity
Dog, Human, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MSGCPFLGNNFGYTFKKLPVEGSEEDKSQTGVNRASKGGLIYGNYLHLEK
Sequence Length
799
Applicable Applications for anti-TDO2 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Dog: 79%; Human: 100%; Pig: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TDO2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-TDO2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Fetal Heart)

product-image-AAA199604_WB8.jpg WB (Western Blot) (WB Suggested Anti-TDO2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Fetal Heart)

WB (Western Blot)

(Host: RabbitTarget Name: TDO2Sample Tissue: Human 786-0 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA199604_WB10.jpg WB (Western Blot) (Host: RabbitTarget Name: TDO2Sample Tissue: Human 786-0 Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: TDO2Sample Tissue: Human 293T Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA199604_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: TDO2Sample Tissue: Human 293T Whole CellAntibody Dilution: 1ug/ml)

IHC (Immunohiostchemistry)

(Rabbit Anti-CDH8 AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA199604_IHC13.jpg IHC (Immunohiostchemistry) (Rabbit Anti-CDH8 AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

IHC (Immunohistochemistry)

(Sample Type: Human KidneyAnti-TDO2 antibody IHC of human kidney. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.)

product-image-AAA199604_IHC15.jpg IHC (Immunohistochemistry) (Sample Type: Human KidneyAnti-TDO2 antibody IHC of human kidney. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.)
Related Product Information for anti-TDO2 antibody
This is a rabbit polyclonal antibody against TDO2. It was validated on Western Blot and immunohistochemistry

Target Description: Tryptophan 2,3-dioxygenase (EC 1.13.11.11) plays a role in catalyzing the first and rat-limiting step in the kynurenine pathway, the major pathway of tryptophan metabolism.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48kDa
NCBI Official Full Name
tryptophan 2,3-dioxygenase
NCBI Official Synonym Full Names
tryptophan 2,3-dioxygenase
NCBI Official Symbol
TDO2
NCBI Official Synonym Symbols
TO; TDO; TPH2; TRPO; HYPTRP
NCBI Protein Information
tryptophan 2,3-dioxygenase
UniProt Protein Name
Tryptophan 2,3-dioxygenase
UniProt Gene Name
TDO2
UniProt Entry Name
T23O_HUMAN

Similar Products

Product Notes

The TDO2 tdo2 (Catalog #AAA199604) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TDO2 antibody - N-terminal region reacts with Dog, Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's TDO2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the TDO2 tdo2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MSGCPFLGNN FGYTFKKLPV EGSEEDKSQT GVNRASKGGL IYGNYLHLEK. It is sometimes possible for the material contained within the vial of "TDO2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.