Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online
product-image-AAA11686_IHC4.jpg IHC (Immunohistochemistry) (TECTA was detected in paraffin-embedded sections of human testis tissues using rabbit anti- TECTA Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

Rabbit TECTA Polyclonal Antibody | anti-TECTA antibody

Anti-TECTA Antibody

Gene Names
TECTA; DFNA8; DFNA12; DFNB21
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Immunogen affinity purified.
Synonyms
TECTA, Antibody; Anti-TECTA Antibody; Alpha-tectorin; tectorin alpha; anti-TECTA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
Rabbit IgG
Specificity
No cross reactivity with other proteins.
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Sequence Length
2155
Applicable Applications for anti-TECTA antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes
Western Blot:
Concentration: 0.1-0.5ug/ml
Tested Species: Hu, Ms, Rat

Immunohistochemistry(IHC) (Paraffin-embedded Section:
Concentration: 0.5-1ug/ml
Tested Species: Hu
Antigen Retrieval: By Heat

Tested Species: In-house tested species with positive results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Optimal dilutions should be determined by end users.

Antibody can be supported by chemiluminescence kit
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human TECTA (93-134aa RAFVAPFWADVHNGIRGEIYYRETMEPAILKRATKDIRKYFK), different from the related mouse sequence by three amino acids.
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemistry)

(TECTA was detected in paraffin-embedded sections of human testis tissues using rabbit anti- TECTA Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA11686_IHC4.jpg IHC (Immunohistochemistry) (TECTA was detected in paraffin-embedded sections of human testis tissues using rabbit anti- TECTA Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

IHC (Immunohistochemistry)

(TECTA was detected in paraffin-embedded sections of human lung cancer tissues using rabbit anti- TECTA Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA11686_IHC3.jpg IHC (Immunohistochemistry) (TECTA was detected in paraffin-embedded sections of human lung cancer tissues using rabbit anti- TECTA Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

IHC (Immunohistochemistry)

(TECTA was detected in paraffin-embedded sections of human intetsinal cancer tissues using rabbit anti- TECTA Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA11686_IHC2.jpg IHC (Immunohistochemistry) (TECTA was detected in paraffin-embedded sections of human intetsinal cancer tissues using rabbit anti- TECTA Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

WB (Western Blot)

(Western blot analysis of TECTA expression in rat testis extract (lane 1), HEPA1-6 whole cell lysates (lane 2) and HEPG2 whole cell lysates (lane 3). TECTA at 239KD was detected using rabbit anti- TECTA Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.)

product-image-AAA11686_WB.jpg WB (Western Blot) (Western blot analysis of TECTA expression in rat testis extract (lane 1), HEPA1-6 whole cell lysates (lane 2) and HEPG2 whole cell lysates (lane 3). TECTA at 239KD was detected using rabbit anti- TECTA Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.)
Related Product Information for anti-TECTA antibody
Rabbit IgG polyclonal antibody for Alpha-tectorin(TECTA) detection.
Background: Alpha-tectorin is a protein that in humans is encoded by the TECTA gene. The tectorial membrane is an extracellular matrix of the inner ear that contacts the stereocilia bundles of specialized sensory hair cells. Sound induces movement of these hair cells relative to the tectorial membrane, deflects the stereocilia, and leads to fluctuations in hair-cell membrane potential, transducing sound into electrical signals. Alpha-tectorin is one of the major noncollagenous components of the tectorial membrane. Mutations in the TECTA gene have been shown to be responsible for autosomal dominant nonsyndromic hearing impairment and a recessive form of sensorineural pre-lingual non-syndromic deafness.
References
1. "Entrez Gene: TECTA tectorin alpha".
2. Hughes DC, Legan PK, Steel KP, Richardson GP (Apr 1998). "Mapping of the alpha-tectorin gene (TECTA) to mouse chromosome 9 and human chromosome 11: a candidate for human autosomal dominant nonsyndromic deafness". Genomics. 48 (1): 46-51.
3. Verhoeven K, Van Laer L, Kirschhofer K, Legan PK, Hughes DC, Schatteman I, Verstreken M, Van Hauwe P, Coucke P, Chen A, Smith RJ, Somers T, Offeciers FE, Van de Heyning P, Richardson GP, Wachtler F, Kimberling WJ, Willems PJ, Govaerts PJ, Van Camp G (May 1998). "Mutations in the human alpha-tectorin gene cause autosomal dominant non-syndromic hearing impairment". Nat Genet. 19 (1): 60-2.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
alpha-tectorin
NCBI Official Synonym Full Names
tectorin alpha
NCBI Official Symbol
TECTA
NCBI Official Synonym Symbols
DFNA8; DFNA12; DFNB21
NCBI Protein Information
alpha-tectorin
UniProt Protein Name
Alpha-tectorin
UniProt Gene Name
TECTA

Similar Products

Product Notes

The TECTA tecta (Catalog #AAA11686) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-TECTA Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TECTA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC) Paraffin. Western Blot: Concentration: 0.1-0.5ug/ml Tested Species: Hu, Ms, Rat Immunohistochemistry(IHC) (Paraffin-embedded Section: Concentration: 0.5-1ug/ml Tested Species: Hu Antigen Retrieval: By Heat Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Antibody can be supported by chemiluminescence kit. Researchers should empirically determine the suitability of the TECTA tecta for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TECTA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.