WB (Western Blot)
(WB Suggested Anti-TES AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole CellTES is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)
Rabbit TES Polyclonal Antibody | anti-TES antibody
TES antibody - middle region
Gene Names
TES; TESS; TESS-2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Pig, Sheep
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
TES, Antibody; TES antibody - middle region; anti-TES antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Pig, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PKQMNIPGGDRSTPAAVGAMEDKSAEHKRTQYSCYCCKLSMKEGDPAIYA
Sequence Length
421
Applicable Applications for anti-TES antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 91%; Horse: 79%; Human: 100%; Pig: 93%; Sheep: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-TES AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole CellTES is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)
WB (Western Blot)
(WB Suggested Anti-TES AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole CellTES is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)
IHC (Immunohistochemistry)
(Rabbit Anti-TES AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Thyroid TissueObserved Staining: Cytoplasm in follicular cellsPrimary Antibody Concentration: N/AOther Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
IHC (Immunohistochemistry)
(Rabbit Anti-TES AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Thyroid TissueObserved Staining: Cytoplasm in follicular cellsPrimary Antibody Concentration: N/AOther Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-TES antibody
This is a rabbit polyclonal antibody against TES. It was validated on Western Blot
Target Description: Cancer-associated chromosomal changes often involve regions containing fragile sites. This gene maps to a commom fragile site on chromosome 7q31.2 designated FRA7G. This gene is similar to mouse Testin, a testosterone-responsive gene encoding a Sertoli cell secretory protein containing three LIM domains. LIM domains are double zinc-finger motifs that mediate protein-protein interactions between transcription factors, cytoskeletal proteins and signaling proteins. This protein is a negative regulator of cell growth and may act as a tumor suppressor. This scaffold protein may also play a role in cell adhesion, cell spreading and in the reorganization of the actin cytoskeleton. Multiple protein isoforms are encoded by transcript variants of this gene.
Target Description: Cancer-associated chromosomal changes often involve regions containing fragile sites. This gene maps to a commom fragile site on chromosome 7q31.2 designated FRA7G. This gene is similar to mouse Testin, a testosterone-responsive gene encoding a Sertoli cell secretory protein containing three LIM domains. LIM domains are double zinc-finger motifs that mediate protein-protein interactions between transcription factors, cytoskeletal proteins and signaling proteins. This protein is a negative regulator of cell growth and may act as a tumor suppressor. This scaffold protein may also play a role in cell adhesion, cell spreading and in the reorganization of the actin cytoskeleton. Multiple protein isoforms are encoded by transcript variants of this gene.
Product Categories/Family for anti-TES antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
testin isoform 1
NCBI Official Synonym Full Names
testin LIM domain protein
NCBI Official Symbol
TES
NCBI Official Synonym Symbols
TESS; TESS-2
NCBI Protein Information
testin
UniProt Protein Name
Testin
UniProt Gene Name
TES
UniProt Entry Name
TES_HUMAN
Similar Products
Product Notes
The TES tes (Catalog #AAA201157) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TES antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Pig, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's TES can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the TES tes for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PKQMNIPGGD RSTPAAVGAM EDKSAEHKRT QYSCYCCKLS MKEGDPAIYA. It is sometimes possible for the material contained within the vial of "TES, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.