Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197814_WB13.jpg WB (Western Blot) (WB Suggested Anti-TFB2M Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)

Rabbit TFB2M Polyclonal Antibody | anti-TFB2M antibody

TFB2M antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
TFB2M; Hkp1; mtTFB2
Reactivity
Horse, Human, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
TFB2M, Antibody; TFB2M antibody - N-terminal region; anti-TFB2M antibody
Ordering
Host
Rabbit
Reactivity
Horse, Human, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ECNPGPGILTQALLEAGAKVVALESDKTFIPHLESLGKNLDGKLRVIHCD
Sequence Length
396
Applicable Applications for anti-TFB2M antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Horse: 100%; Human: 100%; Rabbit: 83%; Rat: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TFB2M
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-TFB2M Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)

product-image-AAA197814_WB13.jpg WB (Western Blot) (WB Suggested Anti-TFB2M Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)

IHC (Immunohistochemistry)

(Human Intestine)

product-image-AAA197814_IHC15.jpg IHC (Immunohistochemistry) (Human Intestine)
Related Product Information for anti-TFB2M antibody
This is a rabbit polyclonal antibody against TFB2M. It was validated on Western Blot and immunohistochemistry

Target Description: TFB2M is a S-adenosyl-L-methionine-dependent methyltransferase which specifically dimethylates mitochondrial 12S rRNA at the conserved stem loop. It is also required for basal transcription of mitochondrial DNA, probably via its interaction with POLRMT and TFAM. It stimulates transcription independently of the methyltransferase activity. Compared to TFB1M, it activates transcription of mitochondrial DNA more efficiently, while it has less methyltransferase activity.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
dimethyladenosine transferase 2, mitochondrial
NCBI Official Synonym Full Names
transcription factor B2, mitochondrial
NCBI Official Symbol
TFB2M
NCBI Official Synonym Symbols
Hkp1; mtTFB2
NCBI Protein Information
dimethyladenosine transferase 2, mitochondrial
UniProt Protein Name
Dimethyladenosine transferase 2, mitochondrial
UniProt Gene Name
TFB2M
UniProt Synonym Gene Names
NS5ATP5; HCV NS5A-transactivated protein 5; h-mtTFB; h-mtTFB2; hTFB2M; mtTFB2
UniProt Entry Name
TFB2M_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The TFB2M tfb2m (Catalog #AAA197814) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TFB2M antibody - N-terminal region reacts with Horse, Human, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TFB2M can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the TFB2M tfb2m for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ECNPGPGILT QALLEAGAKV VALESDKTFI PHLESLGKNL DGKLRVIHCD. It is sometimes possible for the material contained within the vial of "TFB2M, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.