Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23459_WB7.jpg WB (Western Blot) (WB Suggested Anti-TGFB1 Antibody Titration: 0.2-1 ug/ml or 1:5000 to 1:1000 dilution.SP2/0 cell lysate)

Rabbit TGFB1 Polyclonal Antibody | anti-TGFB1 antibody

TGFB1 antibody - middle region

Gene Names
Tgfb1; Tgfb; Tgfb-1; TGFbeta1; TGF-beta1
Reactivity
Predicted Reactivity: Cow, Dog, Goat, Guinea Pig, Horse, Mouse, Pig, Rat, Sheep (Tested Reactivity: Human, Mouse)
Applications
Immunohistochemistry, Western Blot, Immunofluorescence
Purity
Affinity Purified
Synonyms
TGFB1, Antibody; TGFB1 antibody - middle region; anti-TGFB1 antibody
Ordering
Host
Rabbit
Reactivity
Predicted Reactivity: Cow, Dog, Goat, Guinea Pig, Horse, Mouse, Pig, Rat, Sheep (Tested Reactivity: Human, Mouse)
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DTPEWLSFDVTGVVRQWLNQGDGIQGFRFSAHCSCDSKDNKLHVEINGIS
Sequence Length
390
Applicable Applications for anti-TGFB1 antibody
IHC (Immunohistochemistry), WB (Western Blot), IF (Immunofluorescence)
Homology
Cow: 79%; Dog: 79%; Goat: 79%; Guinea Pig: 87%; Horse: 79%; Mouse: 100%; Pig: 93%; Rat: 93%; Sheep: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse TGFB1
Protein Size (# AA)
390 amino acids
Protein Interactions
Htra1; Nrep; Ltbp3; Col1a1; Tgfbr3; Tgfbr1; Tgfbr2; Smad4; Hdac3; Jun;
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-TGFB1 Antibody Titration: 0.2-1 ug/ml or 1:5000 to 1:1000 dilution.SP2/0 cell lysate)

product-image-AAA23459_WB7.jpg WB (Western Blot) (WB Suggested Anti-TGFB1 Antibody Titration: 0.2-1 ug/ml or 1:5000 to 1:1000 dilution.SP2/0 cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: TGFB1Sample Tissue: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

product-image-AAA23459_WB6.jpg WB (Western Blot) (Host: RabbitTarget Name: TGFB1Sample Tissue: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: TGFB1Sample Tissue: Mouse SpleenAntibody Dilution: 1ug/ml)

product-image-AAA23459_WB5.jpg WB (Western Blot) (Host: MouseTarget Name: TGFB1Sample Tissue: Mouse SpleenAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: TGFB1Sample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)

product-image-AAA23459_WB4.jpg WB (Western Blot) (Host: MouseTarget Name: TGFB1Sample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(TGFB1 in human prostate cancer tissue was detected using HRP/AEC red color stain.Working dilutions: 5-10 ug/ml.)

product-image-AAA23459_IHC3.jpg IHC (Immunohistochemistry) (TGFB1 in human prostate cancer tissue was detected using HRP/AEC red color stain.Working dilutions: 5-10 ug/ml.)

IHC (Immunohistochemistry)

(Human Spleen)

product-image-AAA23459_IHC2.jpg IHC (Immunohistochemistry) (Human Spleen)

IF (Immunofluorescence)

(Immunofluorescent TGFB1 detection in mouse kidney (red fluorescence). Nuclei were stained with DAPI (blue fluorescence).Working dilutions: 5-10 ug/ml)

product-image-AAA23459_IF.jpg IF (Immunofluorescence) (Immunofluorescent TGFB1 detection in mouse kidney (red fluorescence). Nuclei were stained with DAPI (blue fluorescence).Working dilutions: 5-10 ug/ml)
Related Product Information for anti-TGFB1 antibody
This is a rabbit polyclonal antibody against TGFB1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Tgfb1 is a multifunctional protein that control proliferation, differentiation, and other functions in many cell types. Many cells synthesize TGFB1 and essentially all of them have specific receptors for this protein. It regulates the actions of many other growth factors and determines a positive or negative direction of their effects. It plays an important role in bone remodelling. It is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
transforming growth factor beta-1 proprotein preproprotein
NCBI Official Synonym Full Names
transforming growth factor, beta 1
NCBI Official Symbol
Tgfb1
NCBI Official Synonym Symbols
Tgfb; Tgfb-1; TGFbeta1; TGF-beta1
NCBI Protein Information
transforming growth factor beta-1 proprotein
UniProt Protein Name
Transforming growth factor beta-1
UniProt Gene Name
Tgfb1
UniProt Synonym Gene Names
TGF-beta-1; LAP
UniProt Entry Name
TGFB1_MOUSE

Similar Products

Product Notes

The TGFB1 tgfb1 (Catalog #AAA23459) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TGFB1 antibody - middle region reacts with Predicted Reactivity: Cow, Dog, Goat, Guinea Pig, Horse, Mouse, Pig, Rat, Sheep (Tested Reactivity: Human, Mouse) and may cross-react with other species as described in the data sheet. AAA Biotech's TGFB1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot), IF (Immunofluorescence). Researchers should empirically determine the suitability of the TGFB1 tgfb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DTPEWLSFDV TGVVRQWLNQ GDGIQGFRFS AHCSCDSKDN KLHVEINGIS. It is sometimes possible for the material contained within the vial of "TGFB1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.