<
WB (Western Blot)
(Host: RabbitTarget Name: TGFB2Sample Tissue: Mouse Small IntestineAntibody Dilution: 1ug/ml)
Rabbit TGFB2 Polyclonal Antibody | anti-TGFB2 antibody
TGFB2 antibody - middle region
Gene Names
TGFB2; LDS4; G-TSF; TGF-beta2
Reactivity
Predicted Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TGFB2, Antibody; TGFB2 antibody - middle region; anti-TGFB2 antibody
Host
Rabbit
Reactivity
Predicted Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
NLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKT
Applicable Applications for anti-TGFB2 antibody
WB (Western Blot)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TGFB2
Protein Size (# AA)
414 amino acids
Blocking Peptide
For anti-TGFB2 (MBS3207762) antibody is Catalog # MBS3232728
Protein Interactions
CEBPA; UBC; VASN; PZP; LTBP3; TGFBR3; FMOD; VTN; TGFB3; TGFB2; TGFBR2; TGFBR1; TGFB1; ENG; CTGF; BMP2; APP; TGFBRAP1; DAXX; DCN;
Predicted Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 93%
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(Host: RabbitTarget Name: TGFB2Sample Tissue: Mouse Small IntestineAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: TGFB2Sample Tissue: Mouse Small IntestineAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: MouseTarget Name: TGFB2Sample Tissue: Mouse Small IntestineAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: MouseTarget Name: TGFB2Sample Tissue: Mouse Small IntestineAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: RabbitTarget: TGFB2Positive control (+): THP-1 (N30)Negative control (-): U937 (N31)Antibody concentration: 3ug/ml)
WB (Western Blot)
(Host: RabbitTarget: TGFB2Positive control (+): THP-1 (N30)Negative control (-): U937 (N31)Antibody concentration: 3ug/ml)
WB (Western Blot)
(WB Suggested Anti-TGFB2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: NCI-H226 cell lysateThere is BioGPS gene expression data showing that TGFB2 is expressed in NCIH226.)
WB (Western Blot)
(WB Suggested Anti-TGFB2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: NCI-H226 cell lysateThere is BioGPS gene expression data showing that TGFB2 is expressed in NCIH226.)
Related Product Information for anti-TGFB2 antibody
This gene encodes a member of the transforming growth factor beta (TGFB) family of cytokines, which are multifunctional peptides that regulate proliferation, differentiation, adhesion, migration, and other functions in many cell types by transducing their signal through combinations of transmembrane type I and type II receptors (TGFBR1 and TGFBR2) and their downstream effectors, the SMAD proteins. Disruption of the TGFB/SMAD pathway has been implicated in a variety of human cancers. The encoded protein is secreted and has suppressive effects of interleukin-2 dependent T-cell growth. Translocation t(1;7)(q41;p21) between this gene and HDAC9 is associated with Peters' anomaly, a congenital defect of the anterior chamber of the eye. The knockout mice lacking this gene show perinatal mortality and a wide range of developmental, including cardiac, defects. Alternatively spliced transcript variants encoding different isoforms have been identified.
Product Categories/Family for anti-TGFB2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
transforming growth factor beta-2 proprotein isoform 2 preproprotein
NCBI Official Synonym Full Names
transforming growth factor beta 2
NCBI Official Symbol
TGFB2
NCBI Official Synonym Symbols
LDS4; G-TSF; TGF-beta2
NCBI Protein Information
transforming growth factor beta-2 proprotein
UniProt Protein Name
Transforming growth factor beta-2
UniProt Gene Name
TGFB2
UniProt Synonym Gene Names
TGF-beta-2; G-TSF; LAP
UniProt Entry Name
TGFB2_HUMAN
Similar Products
Product Notes
The TGFB2 tgfb2 (Catalog #AAA199557) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TGFB2 antibody - middle region reacts with Predicted Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's TGFB2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the TGFB2 tgfb2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: NLVKAEFRVF RLQNPKARVP EQRIELYQIL KSKDLTSPTQ RYIDSKVVKT. It is sometimes possible for the material contained within the vial of "TGFB2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.