Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201376_WB13.jpg WB (Western Blot) (WB Suggested Anti-TIGIT AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)

Rabbit anti-Human TIGIT Polyclonal Antibody | anti-TIGIT antibody

TIGIT Antibody - C-terminal region

Gene Names
TIGIT; VSIG9; VSTM3; WUCAM
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TIGIT, Antibody; TIGIT Antibody - C-terminal region; anti-TIGIT antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5mg/mL (varies by lot)
Sequence
Synthetic peptide located within the following region: ALRIHSVEGDLRRKSAGQEEWSPSAPSPPGSCVQAEAAPAGLCGEQRGED
Sequence Length
244
Applicable Applications for anti-TIGIT antibody
WB (Western Blot)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human TIGIT
Protein Size (#AA)
244 amino acids
Protein Interactions
PVRL4; PVRL3; PVRL2; PVR;
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-TIGIT AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)

product-image-AAA201376_WB13.jpg WB (Western Blot) (WB Suggested Anti-TIGIT AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)

WB (Western Blot)

(Host: RabbitTarget: TIGITPositive control (+): ~25ug Human lung (LU)Negative control (-): ~25ug Human Ovary (OV)Antibody concentration: 0.5ug/ml)

product-image-AAA201376_WB15.jpg WB (Western Blot) (Host: RabbitTarget: TIGITPositive control (+): ~25ug Human lung (LU)Negative control (-): ~25ug Human Ovary (OV)Antibody concentration: 0.5ug/ml)
Related Product Information for anti-TIGIT antibody
This is a rabbit polyclonal antibody against TIGIT. It was validated on Western Blot

Target Description: This gene encodes a member of the PVR (poliovirus receptor) family of immunoglobin proteins. The product of this gene is expressed on several classes of T cells including follicular B helper T cells (TFH). The protein has been shown to bind PVR with high affinity; this binding is thought to assist interactions between TFH and dendritic cells to regulate T cell dependent B cell responses.
Product Categories/Family for anti-TIGIT antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26kDa
NCBI Official Full Name
T-cell immunoreceptor with Ig and ITIM domains
NCBI Official Synonym Full Names
T cell immunoreceptor with Ig and ITIM domains
NCBI Official Symbol
TIGIT
NCBI Official Synonym Symbols
VSIG9; VSTM3; WUCAM
NCBI Protein Information
T-cell immunoreceptor with Ig and ITIM domains
UniProt Protein Name
T-cell immunoreceptor with Ig and ITIM domains
UniProt Gene Name
TIGIT
UniProt Synonym Gene Names
VSIG9; VSTM3

Similar Products

Product Notes

The TIGIT tigit (Catalog #AAA201376) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TIGIT Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TIGIT can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the TIGIT tigit for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ALRIHSVEGD LRRKSAGQEE WSPSAPSPPG SCVQAEAAPA GLCGEQRGED. It is sometimes possible for the material contained within the vial of "TIGIT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.