Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA28321_IF6.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U-2 OS cells using TIMM8B Polyclonal Antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

Rabbit TIMM8B Polyclonal Antibody | anti-TIMM8B antibody

TIMM8B Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
TIMM8B; DDP2; TIM8B
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry, Immunofluorescence
Purity
Affinity purification
Synonyms
TIMM8B, Antibody; TIMM8B Rabbit pAb; TIMM8B; DDP2; TIM8B; anti-TIMM8B antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MAELGEADEAELQRLVAAEQQKAQFTAQVHHFMELCWDKCVEKPGNRLDSRTENCLSSCVDRFIDTTLAITSRFAQIVQKGGQ
Applicable Applications for anti-TIMM8B antibody
WB (Western Blot), IHC (Immunohistochemistry), IF (Immunofluorescence)
Application Notes
WB: 1:500-1:2000
IHC: 1:50-1:100
IF: 1:50-1:100
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 16-98 of human TIMM8B (NP_036591.2).
Cellular Location
Intermembrane side, Mitochondrion inner membrane, Peripheral membrane protein
Positive Samples
293T, A-549, MCF7, Mouse brain, Mouse kidney, Rat liver
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of U-2 OS cells using TIMM8B Polyclonal Antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA28321_IF6.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U-2 OS cells using TIMM8B Polyclonal Antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of L929 cells using TIMM8B Polyclonal Antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA28321_IF5.jpg IF (Immunofluorescence) (Immunofluorescence analysis of L929 cells using TIMM8B Polyclonal Antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded mouse heart using TIMM8B antibody at dilution of 1:100 (40x lens).)

product-image-AAA28321_IHC4.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded mouse heart using TIMM8B antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human breast cancer using TIMM8B antibody at dilution of 1:100 (40x lens).)

product-image-AAA28321_IHC3.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human breast cancer using TIMM8B antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded rat brain using TIMM8B antibody at dilution of 1:100 (40x lens).)

product-image-AAA28321_IHC2.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded rat brain using TIMM8B antibody at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using TIMM8B antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

product-image-AAA28321_WB.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using TIMM8B antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Related Product Information for anti-TIMM8B antibody
Background: This gene encodes a member of a well-conserved family of proteins with similarity to yeast Tim mitochondrial import proteins. This gene is encoded by a nuclear gene and is transported into the intermembrane space of the mitochondrion. When formed into complexes, these proteins guide membrane-spanning proteins across the mitochondrial intermembrane space before they are added into the mitochondrial inner membrane. This gene is adjacent to succinate dehydrogenase, subunit D (SDHD), in which mutations have been found in affected members of families with hereditary paraganglioma.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
9,344 Da
NCBI Official Full Name
TIMM8b
NCBI Official Synonym Full Names
translocase of inner mitochondrial membrane 8 homolog B (yeast)
NCBI Official Symbol
TIMM8B
NCBI Official Synonym Symbols
DDP2; TIM8B
NCBI Protein Information
mitochondrial import inner membrane translocase subunit Tim8 B; DDP-like protein; deafness dystonia protein 2
UniProt Protein Name
Mitochondrial import inner membrane translocase subunit Tim8 B
UniProt Gene Name
TIMM8B
UniProt Synonym Gene Names
DDP2; DDPL; TIM8B
UniProt Entry Name
TIM8B_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The TIMM8B timm8b (Catalog #AAA28321) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TIMM8B Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TIMM8B can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry), IF (Immunofluorescence). WB: 1:500-1:2000 IHC: 1:50-1:100 IF: 1:50-1:100. Researchers should empirically determine the suitability of the TIMM8B timm8b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAELGEADEA ELQRLVAAEQ QKAQFTAQVH HFMELCWDKC VEKPGNRLDS RTENCLSSCV DRFIDTTLAI TSRFAQIVQK GGQ. It is sometimes possible for the material contained within the vial of "TIMM8B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.