Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA19469_IF9.jpg IF (Immunofluorescence) (Figure 9. IF analysis of TJP2/ZO2 using anti-TJP2/ZO2 antibody (AAA19469).TJP2/ZO2 was detected in an immunocytochemical section of A431 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (AR0022) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 5 ug/mL rabbit anti-TJP2/ZO2 Antibody (AAA19469) overnight at 4 degree C. DyLight488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37 degree C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.)

Rabbit TJP2/ZO2 Polyclonal Antibody | anti-TJP2 antibody

Anti-TJP2/ZO2 Antibody Picoband

Gene Names
TJP2; ZO2; X104; PFIC4; DFNA51; DUP9q21.11; C9DUPq21.11
Reactivity
Human, Rat, Monkey
Applications
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence
Purity
Immunogen affinity purified.
Synonyms
TJP2/ZO2, Antibody; Anti-TJP2/ZO2 Antibody Picoband; anti-TJP2 antibody
Ordering
Host
Rabbit
Reactivity
Human, Rat, Monkey
Clonality
Polyclonal
Isotype
Rabbit IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4.
Concentration
Adding 0.2 ml of distilled water will yield a concentration of 500 ug/ml. (varies by lot)
Applicable Applications for anti-TJP2 antibody
WB (Western Blot), IHC (Immunohistochemistry), ICC (Immunocytochemistry), IF (Immunofluorescence)
Application Notes
WB: 0.25-0.5 ug/ml, Human, Rat, Monkey
IHC-P: 2-5 ug/ml, Human
ICC/IF: 5 ug/ml, Human
Tested Species: In-house tested species with positive results.
Enhanced Chemiluminescent Kit with anti-Rabbit IgG for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit for IHC(P) and ICC.
Reconstitution
Adding 0.2 ml of distilled water will yield a concentration of 500 ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence of human TJP2/ZO2 (KVKIFEKMDHKARLQRMQELQEAQNARIEIAQKH).
Preparation and Storage
Store at -20 degree C for one year from date of receipt. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for six months. Avoid repeated freezing and thawing.

IF (Immunofluorescence)

(Figure 9. IF analysis of TJP2/ZO2 using anti-TJP2/ZO2 antibody (AAA19469).TJP2/ZO2 was detected in an immunocytochemical section of A431 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (AR0022) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 5 ug/mL rabbit anti-TJP2/ZO2 Antibody (AAA19469) overnight at 4 degree C. DyLight488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37 degree C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.)

product-image-AAA19469_IF9.jpg IF (Immunofluorescence) (Figure 9. IF analysis of TJP2/ZO2 using anti-TJP2/ZO2 antibody (AAA19469).TJP2/ZO2 was detected in an immunocytochemical section of A431 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (AR0022) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 5 ug/mL rabbit anti-TJP2/ZO2 Antibody (AAA19469) overnight at 4 degree C. DyLight488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37 degree C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.)

IHC (Immunohistochemistry)

(Figure 8. IHC analysis of TJP2/ZO2 using anti-TJP2/ZO2 antibody (AAA19469).TJP2/ZO2 was detected in a paraffin-embedded section of human squamous metaplasia of the renal pelvis tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml rabbit anti-TJP2/ZO2 Antibody (AAA19469) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

product-image-AAA19469_IHC8.jpg IHC (Immunohistochemistry) (Figure 8. IHC analysis of TJP2/ZO2 using anti-TJP2/ZO2 antibody (AAA19469).TJP2/ZO2 was detected in a paraffin-embedded section of human squamous metaplasia of the renal pelvis tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml rabbit anti-TJP2/ZO2 Antibody (AAA19469) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 7. IHC analysis of TJP2/ZO2 using anti-TJP2/ZO2 antibody (AAA19469).TJP2/ZO2 was detected in a paraffin-embedded section of human ovarian serous adenocarcinoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml rabbit anti-TJP2/ZO2 Antibody (AAA19469) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

product-image-AAA19469_IHC7.jpg IHC (Immunohistochemistry) (Figure 7. IHC analysis of TJP2/ZO2 using anti-TJP2/ZO2 antibody (AAA19469).TJP2/ZO2 was detected in a paraffin-embedded section of human ovarian serous adenocarcinoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml rabbit anti-TJP2/ZO2 Antibody (AAA19469) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

IHC (Immunohistchemistry)

(Figure 6. IHC analysis of TJP2/ZO2 using anti-TJP2/ZO2 antibody (AAA19469).TJP2/ZO2 was detected in a paraffin-embedded section of human bladder cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml rabbit anti-TJP2/ZO2 Antibody (AAA19469) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

product-image-AAA19469_IHC6.jpg IHC (Immunohistchemistry) (Figure 6. IHC analysis of TJP2/ZO2 using anti-TJP2/ZO2 antibody (AAA19469).TJP2/ZO2 was detected in a paraffin-embedded section of human bladder cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml rabbit anti-TJP2/ZO2 Antibody (AAA19469) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 5. IHC analysis of TJP2/ZO2 using anti-TJP2/ZO2 antibody (AAA19469).TJP2/ZO2 was detected in a paraffin-embedded section of human differentiated adenocarcinoma of the rectum tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml rabbit anti-TJP2/ZO2 Antibody (AAA19469) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

product-image-AAA19469_IHC5.jpg IHC (Immunohistochemistry) (Figure 5. IHC analysis of TJP2/ZO2 using anti-TJP2/ZO2 antibody (AAA19469).TJP2/ZO2 was detected in a paraffin-embedded section of human differentiated adenocarcinoma of the rectum tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml rabbit anti-TJP2/ZO2 Antibody (AAA19469) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 4. IHC analysis of TJP2/ZO2 using anti-TJP2/ZO2 antibody (AAA19469).TJP2/ZO2 was detected in a paraffin-embedded section of human liver cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml rabbit anti-TJP2/ZO2 Antibody (AAA19469) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

product-image-AAA19469_IHC4.jpg IHC (Immunohistochemistry) (Figure 4. IHC analysis of TJP2/ZO2 using anti-TJP2/ZO2 antibody (AAA19469).TJP2/ZO2 was detected in a paraffin-embedded section of human liver cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml rabbit anti-TJP2/ZO2 Antibody (AAA19469) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 3. IHC analysis of TJP2/ZO2 using anti-TJP2/ZO2 antibody (AAA19469).TJP2/ZO2 was detected in a paraffin-embedded section of human papillary carcinoma of the left breast tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml rabbit anti-TJP2/ZO2 Antibody (AAA19469) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

product-image-AAA19469_IHC3.jpg IHC (Immunohistochemistry) (Figure 3. IHC analysis of TJP2/ZO2 using anti-TJP2/ZO2 antibody (AAA19469).TJP2/ZO2 was detected in a paraffin-embedded section of human papillary carcinoma of the left breast tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml rabbit anti-TJP2/ZO2 Antibody (AAA19469) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 2. IHC analysis of TJP2/ZO2 using anti-TJP2/ZO2 antibody (AAA19469).TJP2/ZO2 was detected in a paraffin-embedded section of human infiltrating adenocarcinoma of the lung tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml rabbit anti-TJP2/ZO2 Antibody (AAA19469) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

product-image-AAA19469_IHC2.jpg IHC (Immunohistochemistry) (Figure 2. IHC analysis of TJP2/ZO2 using anti-TJP2/ZO2 antibody (AAA19469).TJP2/ZO2 was detected in a paraffin-embedded section of human infiltrating adenocarcinoma of the lung tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml rabbit anti-TJP2/ZO2 Antibody (AAA19469) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

WB (Western Blot)

(Figure 1. Western blot analysis of TJP2/ZO2 using anti-TJP2/ZO2 antibody (AAA19469).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.Lane 1: human Hela whole cell lysates,Lane 2: human MCF-7 whole cell lysates,Lane 3: monkey COS-7 whole cell lysates,Lane 4: rat PC-12 whole cell lysates.After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-TJP2/ZO2 antigen affinity purified polyclonal antibody (#AAA19469) at 0.5 ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for TJP2/ZO2 at approximately 150-170 kDa. The expected band size for TJP2/ZO2 is at 134 kDa.)

product-image-AAA19469_WB.jpg WB (Western Blot) (Figure 1. Western blot analysis of TJP2/ZO2 using anti-TJP2/ZO2 antibody (AAA19469).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.Lane 1: human Hela whole cell lysates,Lane 2: human MCF-7 whole cell lysates,Lane 3: monkey COS-7 whole cell lysates,Lane 4: rat PC-12 whole cell lysates.After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-TJP2/ZO2 antigen affinity purified polyclonal antibody (#AAA19469) at 0.5 ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for TJP2/ZO2 at approximately 150-170 kDa. The expected band size for TJP2/ZO2 is at 134 kDa.)
Related Product Information for anti-TJP2 antibody
TJP2(Tight Junction Protein 2), also known as Zona Occludens 2 or ZO2 is a protein that in humans is encoded by the TJP2 gene. Tight junction proteins(TJPs) belong to a family of membrane-associated guanylate kinase(MAGUK) homologs that are involved in the organization of epithelial and endothelial intercellular junctions. Duclos et al.(1994) mapped the TJP2 gene telomeric to the Friedreich ataxia critical region on chromosome 9q13-q21. TJP2 lies about 70 kb centromeric to the X123 gene and is transcribed in the centromere-to-telomere direction. Using in vitro assays and immunoprecipitation studies, Itoh et al.(1999) showed that the mouse Tjp1, Tjp2, and Tjp3 PDZ1 domains interacted with the C-terminal cytoplasmic domains of Cldn1 through Cldn8. In the mouse inner ear, Walsh et al.(2010) found that Tjp2 expression decreased rapidly between E16.5 and age 1 week to a level in adult mice that was approximately 50% of the level at birth(P0).
Product Categories/Family for anti-TJP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
133,958 Da
NCBI Official Full Name
tight junction protein ZO-2 isoform 1
NCBI Official Synonym Full Names
tight junction protein 2
NCBI Official Symbol
TJP2
NCBI Official Synonym Symbols
ZO2; X104; PFIC4; DFNA51; DUP9q21.11; C9DUPq21.11
NCBI Protein Information
tight junction protein ZO-2; zona occludens 2; zonula occludens protein 2; Friedreich ataxia region gene X104 (tight junction protein ZO-2)
UniProt Protein Name
Tight junction protein ZO-2
UniProt Gene Name
TJP2
UniProt Synonym Gene Names
X104; ZO2
UniProt Entry Name
ZO2_HUMAN

Similar Products

Product Notes

The TJP2 tjp2 (Catalog #AAA19469) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-TJP2/ZO2 Antibody Picoband reacts with Human, Rat, Monkey and may cross-react with other species as described in the data sheet. AAA Biotech's TJP2/ZO2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry), ICC (Immunocytochemistry), IF (Immunofluorescence). WB: 0.25-0.5 ug/ml, Human, Rat, Monkey IHC-P: 2-5 ug/ml, Human ICC/IF: 5 ug/ml, Human Tested Species: In-house tested species with positive results. Enhanced Chemiluminescent Kit with anti-Rabbit IgG for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit for IHC(P) and ICC. Researchers should empirically determine the suitability of the TJP2 tjp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TJP2/ZO2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.