WB (Western Blot)
(WB Suggested Anti-Tk1 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse liver)
Rabbit Tk1 Polyclonal Antibody | anti-TK1 antibody
Tk1 antibody - middle region
Gene Names
Tk1; Tk-1; Tk1a; Tk1b; D530002A18Rik
Reactivity
Tested Reactivity: Mouse (Predicted Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish)
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Tk1, Antibody; Tk1 antibody - middle region; anti-TK1 antibody
Host
Rabbit
Reactivity
Tested Reactivity: Mouse (Predicted Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish)
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100ul at 0.5-1mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: KAFGSILNLVPLAESVVKLTAVCMECFREAAYTKRLGLEKEVEVIGGADK
Sequence Length
233
Applicable Applications for anti-TK1 antibody
WB (Western Blot)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 92%
Protein Size (#AA)
233 amino acids
Protein Interactions
E2f4, E2f3, E2f2, E2f5, r2f1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-Tk1 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse liver)
WB (Western Blot)
(WB Suggested Anti-Tk1 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse liver)
Related Product Information for anti-TK1 antibody
This is a rabbit polyclonal antibody against Tk1. It was validated on Western Blot
Target Description: The function of this protein remains unknown.
Target Description: The function of this protein remains unknown.
Product Categories/Family for anti-TK1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26kDa
NCBI Official Full Name
thymidine kinase, cytosolic isoform 1
NCBI Official Synonym Full Names
thymidine kinase 1
NCBI Official Symbol
Tk1
NCBI Official Synonym Symbols
Tk-1; Tk1a; Tk1b; D530002A18Rik
NCBI Protein Information
thymidine kinase, cytosolic
UniProt Protein Name
Thymidine kinase, cytosolic
UniProt Gene Name
Tk1
UniProt Synonym Gene Names
Tk-1
UniProt Entry Name
KITH_MOUSE
Similar Products
Product Notes
The TK1 tk1 (Catalog #AAA200828) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Tk1 antibody - middle region reacts with Tested Reactivity: Mouse (Predicted Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish) and may cross-react with other species as described in the data sheet. AAA Biotech's Tk1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the TK1 tk1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KAFGSILNLV PLAESVVKLT AVCMECFREA AYTKRLGLEK EVEVIGGADK. It is sometimes possible for the material contained within the vial of "Tk1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.