Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199931_WB11.jpg WB (Western Blot) (WB Suggested Anti-TKT Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysateTKT is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Rabbit TKT Polyclonal Antibody | anti-TKT antibody

TKT antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
TKT; TK; TKT1; SDDHD; HEL107; HEL-S-48
Reactivity
Cow, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
TKT, Antibody; TKT antibody - N-terminal region; anti-TKT antibody
Ordering
Host
Rabbit
Reactivity
Cow, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ESYHKPDQQKLQALKDTANRLRISSIQATTAAGSGHPTSCCSAAEIMAVL
Sequence Length
623
Applicable Applications for anti-TKT antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TKT
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-TKT Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysateTKT is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

product-image-AAA199931_WB11.jpg WB (Western Blot) (WB Suggested Anti-TKT Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysateTKT is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

IHC (Immunohiostchemistry)

(TKT antibody - N-terminal regionFormalin Fixed Paraffin Embedded Tissue: Human Lung TissueObserved Staining: Cytoplasm of pneumocytesPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA199931_IHC13.jpg IHC (Immunohiostchemistry) (TKT antibody - N-terminal regionFormalin Fixed Paraffin Embedded Tissue: Human Lung TissueObserved Staining: Cytoplasm of pneumocytesPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

IHC (Immunohistochemistry)

(TKT antibody - N-terminal regionFormalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial TissueObserved Staining: Cytoplasm of bronchial epithelial tissuePrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA199931_IHC15.jpg IHC (Immunohistochemistry) (TKT antibody - N-terminal regionFormalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial TissueObserved Staining: Cytoplasm of bronchial epithelial tissuePrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-TKT antibody
This is a rabbit polyclonal antibody against TKT. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TKT belongs to the transketolase family. TKT has been implicated in the latent genetic disease Wernicke-Korsakoff syndrome (WKS), which causes specific brain damage.
Product Categories/Family for anti-TKT antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
68kDa
NCBI Official Full Name
transketolase isoform 1
NCBI Official Synonym Full Names
transketolase
NCBI Official Symbol
TKT
NCBI Official Synonym Symbols
TK; TKT1; SDDHD; HEL107; HEL-S-48
NCBI Protein Information
transketolase
UniProt Protein Name
Transketolase
UniProt Gene Name
TKT
UniProt Synonym Gene Names
TK
UniProt Entry Name
TKT_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The TKT tkt (Catalog #AAA199931) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TKT antibody - N-terminal region reacts with Cow, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's TKT can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the TKT tkt for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ESYHKPDQQK LQALKDTANR LRISSIQATT AAGSGHPTSC CSAAEIMAVL. It is sometimes possible for the material contained within the vial of "TKT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.