WB (Western Blot)
(WB Suggested Anti-TKTL1 Antibody Titration: 1 ug/mlPositive Control: Fetal Stomach cell lysate)
Rabbit TKTL1 Polyclonal Antibody | anti-TKTL1 antibody
TKTL1 antibody - middle region
Gene Names
TKTL1; TKR; TKT2
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
TKTL1, Antibody; TKTL1 antibody - middle region; anti-TKTL1 antibody
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QIQTSRNLDPQPPIEDSPEVNITDVRMTSPPDYRVGDKIATRKACGLALA
Sequence Length
596
Applicable Applications for anti-TKTL1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Dog: 83%; Guinea Pig: 79%; Horse: 77%; Human: 100%; Mouse: 85%; Rabbit: 77%; Rat: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TKTL1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-TKTL1 Antibody Titration: 1 ug/mlPositive Control: Fetal Stomach cell lysate)
WB (Western Blot)
(WB Suggested Anti-TKTL1 Antibody Titration: 1 ug/mlPositive Control: Fetal Stomach cell lysate)
IHC (Immunohistochemistry)
(Immunohistochemistry with Human Testis lysate tissue at an antibody concentration of 5.0ug/ml using anti-TKTL1 antibody)
IHC (Immunohistochemistry)
(Immunohistochemistry with Human Testis lysate tissue at an antibody concentration of 5.0ug/ml using anti-TKTL1 antibody)
Related Product Information for anti-TKTL1 antibody
This is a rabbit polyclonal antibody against TKTL1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: Strong TKTL1 protein expression has been correlated with a certain type of glucose metabolism (aerobic glycolysis; Warburg effect) and to cells which are affected by chronic complications of diabetic patients. In colon and urothelial carcinomas, expression at the protein level is correlated with invasiveness of tumors and poor patient survival.
Target Description: Strong TKTL1 protein expression has been correlated with a certain type of glucose metabolism (aerobic glycolysis; Warburg effect) and to cells which are affected by chronic complications of diabetic patients. In colon and urothelial carcinomas, expression at the protein level is correlated with invasiveness of tumors and poor patient survival.
Product Categories/Family for anti-TKTL1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
65kDa
NCBI Official Full Name
transketolase-like protein 1 isoform a
NCBI Official Synonym Full Names
transketolase like 1
NCBI Official Symbol
TKTL1
NCBI Official Synonym Symbols
TKR; TKT2
NCBI Protein Information
transketolase-like protein 1
UniProt Protein Name
Transketolase-like protein 1
UniProt Gene Name
TKTL1
UniProt Synonym Gene Names
TKR; TKT2; TK 2
Similar Products
Product Notes
The TKTL1 tktl1 (Catalog #AAA200321) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TKTL1 antibody - middle region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TKTL1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the TKTL1 tktl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QIQTSRNLDP QPPIEDSPEV NITDVRMTSP PDYRVGDKIA TRKACGLALA. It is sometimes possible for the material contained within the vial of "TKTL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.