WB (Western Blot)
(WB Suggested Anti-TLR2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human heart)
Rabbit TLR2 Polyclonal Antibody | anti-TLR2 antibody
TLR2 antibody - middle region
Gene Names
TLR2; TIL4; CD282
Reactivity
Tested:HumanPredicted: Cow, Dog, Goat, Horse, Mouse, Pig, Rabbit, Rat, Sheep
Applications
Western Blot, Immunofluorescence
Purity
Affinity Purified
Synonyms
TLR2, Antibody; TLR2 antibody - middle region; anti-TLR2 antibody
Host
Rabbit
Reactivity
Tested:Human
Predicted: Cow, Dog, Goat, Horse, Mouse, Pig, Rabbit, Rat, Sheep
Predicted: Cow, Dog, Goat, Horse, Mouse, Pig, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: VSGMCCALFLLILLTGVLCHRFHGLWYMKMMWAWLQAKRKPRKAPSRNIC
Sequence Length
784
Applicable Applications for anti-TLR2 antibody
WB (Western Blot), IF (Immunofluorescence)
Homology
Cow: 86%; Dog: 93%; Goat: 86%; Horse: 79%; Human: 100%; Mouse: 79%; Pig: 86%; Rabbit: 79%; Rat: 79%; Sheep: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TLR2
Protein Size (#AA)
784 amino acids
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-TLR2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human heart)
WB (Western Blot)
(WB Suggested Anti-TLR2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human heart)
IHC (Immunohiostchemistry)
(Sample Type: human macrophagesSample Type: Human Macrophange CellsGreen: primaryRed: phallodinBlue: DAPIYellow: green/redPrimary Dilution: 1:200Secondary Antibody: anti-Rabbit IgG-FITCSecondary Dilution: 1:1000Image Submitted By: Milan FialaUniversity of California, Los Angeles)
IHC (Immunohiostchemistry)
(Sample Type: human macrophagesSample Type: Human Macrophange CellsGreen: primaryRed: phallodinBlue: DAPIYellow: green/redPrimary Dilution: 1:200Secondary Antibody: anti-Rabbit IgG-FITCSecondary Dilution: 1:1000Image Submitted By: Milan FialaUniversity of California, Los Angeles)
IHC (Immunohistochemistry)
(Sample Type: human macrophagesSample Type: Human Macrophange CellsGreen: primaryRed: phallodinBlue: DAPIYellow: green/redPrimary Dilution: 1:200Secondary Antibody: anti-Rabbit IgG-FITCSecondary Dilution: 1:1000Image Submitted By: Milan FialaUniversity of California, Los Angeles)
IHC (Immunohistochemistry)
(Sample Type: human macrophagesSample Type: Human Macrophange CellsGreen: primaryRed: phallodinBlue: DAPIYellow: green/redPrimary Dilution: 1:200Secondary Antibody: anti-Rabbit IgG-FITCSecondary Dilution: 1:1000Image Submitted By: Milan FialaUniversity of California, Los Angeles)
Related Product Information for anti-TLR2 antibody
This is a rabbit polyclonal antibody against TLR2. It was validated on Western Blot
Target Description: TLR2 is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene is expressed most abundantly in peripheral blood leukocytes, and mediates host response to Gram-positive bacteria and yeast via stimulation of NF-kappaB.
Target Description: TLR2 is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene is expressed most abundantly in peripheral blood leukocytes, and mediates host response to Gram-positive bacteria and yeast via stimulation of NF-kappaB.
Product Categories/Family for anti-TLR2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
90kDa
NCBI Official Full Name
toll-like receptor 2
NCBI Official Synonym Full Names
toll like receptor 2
NCBI Official Symbol
TLR2
NCBI Official Synonym Symbols
TIL4; CD282
NCBI Protein Information
toll-like receptor 2
UniProt Protein Name
Toll-like receptor 2
UniProt Gene Name
TLR2
UniProt Synonym Gene Names
TIL4
UniProt Entry Name
TLR2_HUMAN
Similar Products
Product Notes
The TLR2 tlr2 (Catalog #AAA200893) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TLR2 antibody - middle region reacts with Tested:Human Predicted: Cow, Dog, Goat, Horse, Mouse, Pig, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's TLR2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IF (Immunofluorescence). Researchers should empirically determine the suitability of the TLR2 tlr2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VSGMCCALFL LILLTGVLCH RFHGLWYMKM MWAWLQAKRK PRKAPSRNIC. It is sometimes possible for the material contained within the vial of "TLR2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.