Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200904_WB13.jpg WB (Western Blot) (WB Suggested Anti-TLR4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: A549 cell lysate)

Rabbit anti-Human, Rat TLR4 Polyclonal Antibody | anti-TLR4 antibody

TLR4 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
TLR4; TOLL; CD284; TLR-4; ARMD10
Reactivity
Human, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TLR4, Antibody; TLR4 antibody - C-terminal region; anti-TLR4 antibody
Ordering
Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QQVELYRLLSRNTYLEWEDSVLGRHIFWRRLRKALLDGKSWNPEGTVGTG
Sequence Length
839
Applicable Applications for anti-TLR4 antibody
WB (Western Blot)
Homology
Human: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human TLR4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-TLR4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: A549 cell lysate)

product-image-AAA200904_WB13.jpg WB (Western Blot) (WB Suggested Anti-TLR4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: A549 cell lysate)

WB (Western Blot)

(Lanes:Lane 1: Untreated human U251 cell lysateLane 2: IL-1beta treated human U251 cell lysatePrimary Antibody Dilution:1:500Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:500Gene Name:TLR4Submitted by:Anonymous)

product-image-AAA200904_WB15.jpg WB (Western Blot) (Lanes:Lane 1: Untreated human U251 cell lysateLane 2: IL-1beta treated human U251 cell lysatePrimary Antibody Dilution:1:500Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:500Gene Name:TLR4Submitted by:Anonymous)
Related Product Information for anti-TLR4 antibody
This is a rabbit polyclonal antibody against TLR4. It was validated on Western Blot

Target Description: The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This receptor is most abundantly expressed in placenta, and in myelomonocytic subpopulation of the leukocytes. It has been implicated in signal transduction events induced by lipopolysaccharide (LPS) found in most gram-negative bacteria. Mutations in this gene have been associated with differences in LPS responsiveness. Also, several transcript variants of this gene have been found, but the protein coding potential of most of them is uncertain.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
93kDa
NCBI Official Full Name
toll-like receptor 4 isoform A
NCBI Official Synonym Full Names
toll like receptor 4
NCBI Official Symbol
TLR4
NCBI Official Synonym Symbols
TOLL; CD284; TLR-4; ARMD10
NCBI Protein Information
toll-like receptor 4
UniProt Protein Name
Toll-like receptor 4
UniProt Gene Name
TLR4
UniProt Entry Name
TLR4_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The TLR4 tlr4 (Catalog #AAA200904) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TLR4 antibody - C-terminal region reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TLR4 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the TLR4 tlr4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QQVELYRLLS RNTYLEWEDS VLGRHIFWRR LRKALLDGKS WNPEGTVGTG. It is sometimes possible for the material contained within the vial of "TLR4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.