Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281810_WB15.jpg WB (Western Blot) (Western blot analysis of lysates from Mouse uterus, using TM7SF2 Rabbit pAb (AAA281810) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25?g per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 90s)

Rabbit anti-Human, Mouse TM7SF2 Polyclonal Antibody | anti-TM7SF2 antibody

TM7SF2 Rabbit pAb

Gene Names
TM7SF2; ANG1; NET47; DHCR14A
Reactivity
Human, Mouse
Applications
ELISA, Western Blot
Purity
Affinity purification
Synonyms
TM7SF2, Antibody; TM7SF2 Rabbit pAb; ANG1; C14SR; NET47; DHCR14A; TM7SF2; anti-TM7SF2 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Sequence
LAPGGNSGNPIYDFFLGRELNPRICFFDFKYFCELRPGLIGWVLINLALLMKEAELRGSPSLAMWLVNGFQLLYVGDALWHEEAVLTTMDI
Applicable Applications for anti-TM7SF2 antibody
ELISA, WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 160-250 of human TM7SF2 (NP_003264.2).
Buffer
PBS with 0.01% thimerosal,50% glycerol,pH7.3.
Preparation and Storage
Store at -20°C. Avoid freeze/thaw cycles.

WB (Western Blot)

(Western blot analysis of lysates from Mouse uterus, using TM7SF2 Rabbit pAb (AAA281810) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25?g per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 90s)

product-image-AAA281810_WB15.jpg WB (Western Blot) (Western blot analysis of lysates from Mouse uterus, using TM7SF2 Rabbit pAb (AAA281810) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25?g per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 90s)
Related Product Information for anti-TM7SF2 antibody
Background: Enables delta14-sterol reductase activity. Involved in cholesterol biosynthetic process. Located in endoplasmic reticulum. Part of receptor complex.
Product Categories/Family for anti-TM7SF2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Observed MW: 46kDa
Calculated MW: 46kDa
NCBI Official Full Name
delta(14)-sterol reductase isoform 2
NCBI Official Synonym Full Names
transmembrane 7 superfamily member 2
NCBI Official Symbol
TM7SF2
NCBI Official Synonym Symbols
ANG1; NET47; DHCR14A
NCBI Protein Information
delta(14)-sterol reductase; delta(14)-sterol reductase; delta-14-SR; sterol C14-reductase; C-14 sterol reductase; another new gene 1 protein; putative sterol reductase SR-1
UniProt Protein Name
Delta(14)-sterol reductase
UniProt Gene Name
TM7SF2
UniProt Synonym Gene Names
ANG1; Delta-14-SR
UniProt Entry Name
ERG24_HUMAN

Similar Products

Product Notes

The TM7SF2 tm7sf2 (Catalog #AAA281810) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TM7SF2 Rabbit pAb reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's TM7SF2 can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot). Researchers should empirically determine the suitability of the TM7SF2 tm7sf2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LAPGGNSGNP IYDFFLGREL NPRICFFDFK YFCELRPGLI GWVLINLALL MKEAELRGSP SLAMWLVNGF QLLYVGDALW HEEAVLTTMD I. It is sometimes possible for the material contained within the vial of "TM7SF2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.