Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281828_IF8.jpg IF (Immunofluorescence) (Immunofluorescence analysis of A431 cells using TMED3 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Rabbit TMED3 Polyclonal Antibody | anti-TMED3 antibody

TMED3 Rabbit pAb

Gene Names
TMED3; p26; P24B; p24g4; C15orf22
Reactivity
Human, Mouse, Rat
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
TMED3, Antibody; TMED3 Rabbit pAb; C15orf22; P24B; p24g4; p26; TMED3; anti-TMED3 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
PCGAELTFELPDNAKQCFHEEVEQGVKFSLDYQVITGGHYDVDCYVEDPQGNTIYRETKKQYDSFTYRAEVKGVYQFCFSNEFSTFSHKTVYFDFQVGDEPPILPDMGNRVTALTQMESACVTIHEALKTVIDSQTHYRLREAQDRARAEDLNSRVS
Applicable Applications for anti-TMED3 antibody
IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 24-180 of human TMED3 (NP_031390.1).
Positive Samples
MCF7, A-549, A-431
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of A431 cells using TMED3 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA281828_IF8.jpg IF (Immunofluorescence) (Immunofluorescence analysis of A431 cells using TMED3 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded mouse lung using TMED3 antibody at dilution of 1:100 (40x lens).)

product-image-AAA281828_IHC10.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded mouse lung using TMED3 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemisry)

(Immunohistochemistry of paraffin-embedded human colon carcinoma using TMED3 antibody at dilution of 1:100 (40x lens).)

product-image-AAA281828_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded human colon carcinoma using TMED3 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded rat kidney using TMED3 antibody at dilution of 1:100 (40x lens).)

product-image-AAA281828_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded rat kidney using TMED3 antibody at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using TMED3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)

product-image-AAA281828_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using TMED3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19,635 Da
NCBI Official Full Name
transmembrane emp24 domain-containing protein 3 isoform c
NCBI Official Synonym Full Names
transmembrane p24 trafficking protein 3
NCBI Official Symbol
TMED3
NCBI Official Synonym Symbols
p26; P24B; p24g4; C15orf22
NCBI Protein Information
transmembrane emp24 domain-containing protein 3
UniProt Protein Name
Transmembrane emp24 domain-containing protein 3
UniProt Gene Name
TMED3
UniProt Synonym Gene Names
C15orf22; p24gamma4

Similar Products

Product Notes

The TMED3 tmed3 (Catalog #AAA281828) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TMED3 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TMED3 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the TMED3 tmed3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PCGAELTFEL PDNAKQCFHE EVEQGVKFSL DYQVITGGHY DVDCYVEDPQ GNTIYRETKK QYDSFTYRAE VKGVYQFCFS NEFSTFSHKT VYFDFQVGDE PPILPDMGNR VTALTQMESA CVTIHEALKT VIDSQTHYRL REAQDRARAE DLNSRVS. It is sometimes possible for the material contained within the vial of "TMED3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.