Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198838_WB13.jpg WB (Western Blot) (WB Suggested Anti-TMED4 Antibody Titration: 1.25ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysate)

Rabbit TMED4 Polyclonal Antibody | anti-TMED4 antibody

TMED4 antibody - N-terminal region

Gene Names
TMED4; HNLF; ERS25; p24a3; GMP25iso; p24alpha3
Reactivity
Cow, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
TMED4, Antibody; TMED4 antibody - N-terminal region; anti-TMED4 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LRAMGRQALLLLALCATGAQGLYFHIGETEKRCFIEEIPDETMVIGNYRT
Sequence Length
227
Applicable Applications for anti-TMED4 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 79%; Guinea Pig: 79%; Human: 100%; Mouse: 91%; Pig: 86%; Rabbit: 92%; Rat: 86%; Zebrafish: 90%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TMED4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-TMED4 Antibody Titration: 1.25ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysate)

product-image-AAA198838_WB13.jpg WB (Western Blot) (WB Suggested Anti-TMED4 Antibody Titration: 1.25ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysate)

IHC (Immunohistochemistry)

(Rabbit Anti-TMED4 AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA198838_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-TMED4 AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-TMED4 antibody
This is a rabbit polyclonal antibody against TMED4. It was validated on Western Blot and immunohistochemistry

Target Description: TMED4 contains 1 GOLD domain and belongs to the EMP24/GP25L family. The function remains unknown.
Product Categories/Family for anti-TMED4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25kDa
NCBI Official Full Name
transmembrane emp24 domain-containing protein 4 isoform 1
NCBI Official Synonym Full Names
transmembrane p24 trafficking protein 4
NCBI Official Symbol
TMED4
NCBI Official Synonym Symbols
HNLF; ERS25; p24a3; GMP25iso; p24alpha3
NCBI Protein Information
transmembrane emp24 domain-containing protein 4
UniProt Protein Name
Transmembrane emp24 domain-containing protein 4
UniProt Gene Name
TMED4
UniProt Synonym Gene Names
ERS25; ERS25; p24alpha3

Similar Products

Product Notes

The TMED4 tmed4 (Catalog #AAA198838) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TMED4 antibody - N-terminal region reacts with Cow, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's TMED4 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the TMED4 tmed4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LRAMGRQALL LLALCATGAQ GLYFHIGETE KRCFIEEIPD ETMVIGNYRT. It is sometimes possible for the material contained within the vial of "TMED4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.