Rabbit TMEM123 Polyclonal Antibody | anti-TMEM123 antibody
TMEM123 antibody - C-terminal region
Gene Names
TMEM123; KCT3; PORMIN; PORIMIN
Reactivity
Tested Reactivity: HumanPredicted Reactivity: Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TMEM123, Antibody; TMEM123 antibody - C-terminal region; anti-TMEM123 antibody
Host
Rabbit
Reactivity
Tested Reactivity: Human
Predicted Reactivity: Human
Predicted Reactivity: Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
SSVTITTTMHSEAKKGSKFDTGSFVGGIVLTLGVLSILYIGCKMYYSRRG
Applicable Applications for anti-TMEM123 antibody
WB (Western Blot)
Protein Size (# AA)
208 amino acids
Blocking Peptide
For anti-TMEM123 (MBS3209846) antibody is Catalog # MBS3234801
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human TMEM123
Predicted Homology
Human: 100%
Preparation and Storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-TMEM123 antibody
TMEM123 is a highly glycosylated transmembrane protein with a high content of threonine and serine residues in its extracellular domain, similar to a broadly defined category of proteins termed mucins. Exposure of some cell types to anti-PORIMIN (pro-oncosis receptor inducing membrane injury) antibody, crosslinks this protein on the cell surface and induces a type of cell death termed oncosis. Oncosis is distinct from apoptosis and is characterized by a loss of cell membrane integrity without DNA fragmentation. TMEM123 is proposed to function as a cell surface receptor that mediates cell death.This gene encodes a highly glycosylated transmembrane protein with a high content of threonine and serine residues in its extracellular domain, similar to a broadly defined category of proteins termed mucins. Exposure of some cell types to anti-PORIMIN (pro-oncosis receptor inducing membrane injury) antibody, crosslinks this protein on the cell surface and induces a type of cell death termed oncosis. Oncosis is distinct from apoptosis and is characterized by a loss of cell membrane integrity without DNA fragmentation. This gene product is proposed to function as a cell surface receptor that mediates cell death.
Product Categories/Family for anti-TMEM123 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19kDa
NCBI Official Full Name
porimin
NCBI Official Synonym Full Names
transmembrane protein 123
NCBI Official Symbol
TMEM123
NCBI Official Synonym Symbols
KCT3; PORMIN; PORIMIN
NCBI Protein Information
porimin
UniProt Protein Name
Porimin
UniProt Gene Name
TMEM123
UniProt Synonym Gene Names
KCT3; KCT-3
UniProt Entry Name
PORIM_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The TMEM123 tmem123 (Catalog #AAA200076) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TMEM123 antibody - C-terminal region reacts with Tested Reactivity: Human Predicted Reactivity: Human and may cross-react with other species as described in the data sheet. AAA Biotech's TMEM123 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the TMEM123 tmem123 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SSVTITTTMH SEAKKGSKFD TGSFVGGIVL TLGVLSILYI GCKMYYSRRG. It is sometimes possible for the material contained within the vial of "TMEM123, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
