Rabbit TMEM16C Polyclonal Antibody | anti-ANO3 antibody
TMEM16C antibody - C-terminal region
Gene Names
ANO3; DYT23; DYT24; TMEM16C; C11orf25; GENX-3947
Reactivity
Tested Reactivity: HumanPredicted Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TMEM16C, Antibody; TMEM16C antibody - C-terminal region; anti-ANO3 antibody
Host
Rabbit
Reactivity
Tested Reactivity: Human
Predicted Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Sequence
AFVIAITSDYIPRFVYEYKYGPCANHVEPSENCLKGYVNNSLSFFDLSEL
Applicable Applications for anti-ANO3 antibody
WB (Western Blot)
Protein Size (# AA)
981 amino acids
Blocking Peptide
For anti-ANO3 (MBS3209743) antibody is
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human TMEM16C
Replacement Item
This antibody may replace item sc-244370 from Santa Cruz Biotechnology.
Predicted Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-ANO3 antibody
This is a rabbit polyclonal antibody against TMEM16C. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: TMEM16C is a multi-pass membrane proteinPotential. It belongs to the anoctamin family. TMEM16C may act as a calcium-activated chloride channel.
Target Description: TMEM16C is a multi-pass membrane proteinPotential. It belongs to the anoctamin family. TMEM16C may act as a calcium-activated chloride channel.
Product Categories/Family for anti-ANO3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
115kDa
NCBI Official Full Name
anoctamin-3 isoform 2
NCBI Official Synonym Full Names
anoctamin 3
NCBI Official Symbol
ANO3
NCBI Official Synonym Symbols
DYT23; DYT24; TMEM16C; C11orf25; GENX-3947
NCBI Protein Information
anoctamin-3
UniProt Protein Name
Anoctamin-3
UniProt Gene Name
ANO3
UniProt Synonym Gene Names
C11orf25; TMEM16C
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The ANO3 ano3 (Catalog #AAA200057) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TMEM16C antibody - C-terminal region reacts with Tested Reactivity: Human Predicted Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TMEM16C can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the ANO3 ano3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: AFVIAITSDY IPRFVYEYKY GPCANHVEPS ENCLKGYVNN SLSFFDLSEL. It is sometimes possible for the material contained within the vial of "TMEM16C, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
