WB (Western Blot)
(WB Suggested Anti-Tmem33 AntibodyTitration: 1.0 ug/mlPositive Control: Rat Heart)
Rabbit Tmem33 Polyclonal Antibody | anti-TMEM33 antibody
Tmem33 antibody - middle region
Reactivity
Testd Species: RstPredicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Tmem33, Antibody; Tmem33 antibody - middle region; anti-TMEM33 antibody
Host
Rabbit
Reactivity
Testd Species: Rst
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: LLHAATYTKKVLDAKGSNSLPLLRSVLDKLSTNQQNILKFIACNEIFLMP
Sequence Length
247
Applicable Applications for anti-TMEM33 antibody
WB (Western Blot)
Homology
Cow: 92%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Rat
Protein Size (# AA)
247 amino acids
Protein Interactions
CFTR;
Blocking Peptide
For anti-Tmem33 (MBS3208554) antibody is Catalog #
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-Tmem33 AntibodyTitration: 1.0 ug/mlPositive Control: Rat Heart)
WB (Western Blot)
(WB Suggested Anti-Tmem33 AntibodyTitration: 1.0 ug/mlPositive Control: Rat Heart)
Related Product Information for anti-TMEM33 antibody
This is a rabbit polyclonal antibody against Tmem33. It was validated on Western Blot
Target Description: Tmem33 is a putative integral membrane protein.
Target Description: Tmem33 is a putative integral membrane protein.
Product Categories/Family for anti-TMEM33 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
transmembrane protein 33 isoform 2
NCBI Official Synonym Full Names
transmembrane protein 33
NCBI Official Symbol
Tmem33
NCBI Protein Information
transmembrane protein 33
UniProt Protein Name
Transmembrane protein 33
UniProt Gene Name
Tmem33
UniProt Synonym Gene Names
Db83
UniProt Entry Name
TMM33_RAT
Similar Products
Product Notes
The TMEM33 tmem33 (Catalog #AAA199796) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Tmem33 antibody - middle region reacts with Testd Species: Rst Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Tmem33 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the TMEM33 tmem33 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LLHAATYTKK VLDAKGSNSL PLLRSVLDKL STNQQNILKF IACNEIFLMP. It is sometimes possible for the material contained within the vial of "Tmem33, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.