Rabbit TMEM52B Polyclonal Antibody | anti-TMEM52B antibody
TMEM52B Antibody - C-terminal region
Gene Names
TMEM52B; C12orf59
Reactivity
Tested Reactivity: HumanPredicted Reactivity: Human, Mouse, Rat, Cow, Dog, Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TMEM52B, Antibody; TMEM52B Antibody - C-terminal region; anti-TMEM52B antibody
Host
Rabbit
Reactivity
Tested Reactivity: Human
Predicted Reactivity: Human, Mouse, Rat, Cow, Dog, Pig, Rabbit
Predicted Reactivity: Human, Mouse, Rat, Cow, Dog, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Sequence
LGQLPSSLDTLPGYEEALHMSRFTVAMCGQKAPDLPPVPEEKQLPPTEKE
Applicable Applications for anti-TMEM52B antibody
WB (Western Blot)
Protein Size (# AA)
183 amino acids
Protein Interactions
ELAVL1;
Blocking Peptide
For anti-TMEM52B (MBS3218130) antibody is Catalog # MBS3243023
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human TMEM52B
Predicted Homology
Cow: 93%; Dog: 100%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 92%; Rat: 93%
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-TMEM52B antibody
The function of this protein remains unknown.
Product Categories/Family for anti-TMEM52B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20kDa
NCBI Official Full Name
transmembrane protein 52B isoform 1
NCBI Official Synonym Full Names
transmembrane protein 52B
NCBI Official Symbol
TMEM52B
NCBI Official Synonym Symbols
C12orf59
NCBI Protein Information
transmembrane protein 52B
UniProt Protein Name
Transmembrane protein 52B
UniProt Gene Name
TMEM52B
UniProt Synonym Gene Names
C12orf59; UNQ5927/PRO19821
UniProt Entry Name
TM52B_HUMAN
Similar Products
Product Notes
The TMEM52B tmem52b (Catalog #AAA201427) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TMEM52B Antibody - C-terminal region reacts with Tested Reactivity: Human Predicted Reactivity: Human, Mouse, Rat, Cow, Dog, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's TMEM52B can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the TMEM52B tmem52b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LGQLPSSLDT LPGYEEALHM SRFTVAMCGQ KAPDLPPVPE EKQLPPTEKE. It is sometimes possible for the material contained within the vial of "TMEM52B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
