Rabbit anti-Human TMPRSS11D Polyclonal Antibody | anti-TMPRSS11D antibody
TMPRSS11D antibody - middle region
Gene Names
TMPRSS11D; HAT
Reactivity
Human
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
TMPRSS11D, Antibody; TMPRSS11D antibody - middle region; anti-TMPRSS11D antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IHSVCLPAATQNIPPGSTAYVTGWGAQEYAGHTVPELRQGQVRIISNDVC
Sequence Length
418
Applicable Applications for anti-TMPRSS11D antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TMPRSS11D
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-TMPRSS11D antibody
This is a rabbit polyclonal antibody against TMPRSS11D. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: TMPRSS11D is a trypsin-like serine protease released from the submucosal serous glands onto mucous membrane. It is a type II integral membrane protein and has 29-38% identity in the sequence of the catalytic region with human hepsin, enteropeptidase, acrosin, and mast cell tryptase. The noncatalytic region has little similarity to other known proteins. This protein may play some biological role in the host defense system on the mucous membrane independently of or in cooperation with other substances in airway mucous or bronchial secretions. This gene encodes a trypsin-like serine protease released from the submucosal serous glands onto mucous membrane. It is a type II integral membrane protein and has 29-38% identity in the sequence of the catalytic region with human hepsin, enteropeptidase, acrosin, and mast cell tryptase. The noncatalytic region has little similarity to other known proteins. This protein may play some biological role in the host defense system on the mucous membrane independently of or in cooperation with other substances in airway mucous or bronchial secretions.
Target Description: TMPRSS11D is a trypsin-like serine protease released from the submucosal serous glands onto mucous membrane. It is a type II integral membrane protein and has 29-38% identity in the sequence of the catalytic region with human hepsin, enteropeptidase, acrosin, and mast cell tryptase. The noncatalytic region has little similarity to other known proteins. This protein may play some biological role in the host defense system on the mucous membrane independently of or in cooperation with other substances in airway mucous or bronchial secretions. This gene encodes a trypsin-like serine protease released from the submucosal serous glands onto mucous membrane. It is a type II integral membrane protein and has 29-38% identity in the sequence of the catalytic region with human hepsin, enteropeptidase, acrosin, and mast cell tryptase. The noncatalytic region has little similarity to other known proteins. This protein may play some biological role in the host defense system on the mucous membrane independently of or in cooperation with other substances in airway mucous or bronchial secretions.
Product Categories/Family for anti-TMPRSS11D antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
transmembrane protease serine 11D
NCBI Official Synonym Full Names
transmembrane serine protease 11D
NCBI Official Symbol
TMPRSS11D
NCBI Official Synonym Symbols
HAT
NCBI Protein Information
transmembrane protease serine 11D
UniProt Protein Name
Transmembrane protease serine 11D
UniProt Gene Name
TMPRSS11D
UniProt Synonym Gene Names
HAT
UniProt Entry Name
TM11D_HUMAN
Similar Products
Product Notes
The TMPRSS11D tmprss11d (Catalog #AAA199702) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TMPRSS11D antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TMPRSS11D can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the TMPRSS11D tmprss11d for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IHSVCLPAAT QNIPPGSTAY VTGWGAQEYA GHTVPELRQG QVRIISNDVC. It is sometimes possible for the material contained within the vial of "TMPRSS11D, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
