WB (Western Blot)
(WB Suggested Anti-TMPRSS3 Antibody Titration: 5% MilkPositive Control: Mouse Brain lysate)
Rabbit TMPRSS3 Polyclonal Antibody | anti-TMPRSS3 antibody
TMPRSS3 antibody - N-terminal region
Gene Names
TMPRSS3; DFNB8; DFNB10; ECHOS1; TADG12
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TMPRSS3, Antibody; TMPRSS3 antibody - N-terminal region; anti-TMPRSS3 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MGENDPPAVEAPFSFRSLFGLDDLKISPVAPDADAVAAQILSLLPLKFFP
Sequence Length
344
Applicable Applications for anti-TMPRSS3 antibody
WB (Western Blot)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TMPRSS3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-TMPRSS3 Antibody Titration: 5% MilkPositive Control: Mouse Brain lysate)
WB (Western Blot)
(WB Suggested Anti-TMPRSS3 Antibody Titration: 5% MilkPositive Control: Mouse Brain lysate)
WB (Western Blot)
(WB Suggested Anti-TMPRSS3 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)
WB (Western Blot)
(WB Suggested Anti-TMPRSS3 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)
Related Product Information for anti-TMPRSS3 antibody
This is a rabbit polyclonal antibody against TMPRSS3. It was validated on Western Blot
Target Description: This gene encodes a protein that belongs to the serine protease family. The encoded protein contains a serine protease domain, a transmembrane domain, a LDL receptor-like domain, and a scavenger receptor cysteine-rich domain. Serine proteases are known to be involved in a variety of biological processes, whose malfunction often leads to human diseases and disorders. This gene was identified by its association with both congenital and childhood onset autosomal recessive deafness. This gene is expressed in fetal cochlea and many other tissues, and is thought to be involved in the development and maintenance of the inner ear or the contents of the perilymph and endolymph. This gene was also identified as a tumor associated gene that is overexpressed in ovarian tumors. Alternatively spliced transcript variants have been described.
Target Description: This gene encodes a protein that belongs to the serine protease family. The encoded protein contains a serine protease domain, a transmembrane domain, a LDL receptor-like domain, and a scavenger receptor cysteine-rich domain. Serine proteases are known to be involved in a variety of biological processes, whose malfunction often leads to human diseases and disorders. This gene was identified by its association with both congenital and childhood onset autosomal recessive deafness. This gene is expressed in fetal cochlea and many other tissues, and is thought to be involved in the development and maintenance of the inner ear or the contents of the perilymph and endolymph. This gene was also identified as a tumor associated gene that is overexpressed in ovarian tumors. Alternatively spliced transcript variants have been described.
Product Categories/Family for anti-TMPRSS3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
transmembrane protease serine 3 isoform 3
NCBI Official Synonym Full Names
transmembrane serine protease 3
NCBI Official Symbol
TMPRSS3
NCBI Official Synonym Symbols
DFNB8; DFNB10; ECHOS1; TADG12
NCBI Protein Information
transmembrane protease serine 3
UniProt Protein Name
Transmembrane protease serine 3
UniProt Gene Name
TMPRSS3
UniProt Synonym Gene Names
ECHOS1; TADG12
UniProt Entry Name
TMPS3_HUMAN
Similar Products
Product Notes
The TMPRSS3 tmprss3 (Catalog #AAA200724) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TMPRSS3 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TMPRSS3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the TMPRSS3 tmprss3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MGENDPPAVE APFSFRSLFG LDDLKISPVA PDADAVAAQI LSLLPLKFFP. It is sometimes possible for the material contained within the vial of "TMPRSS3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.