Rabbit TMPRSS4 Polyclonal Antibody | anti-TMPRSS4 antibody
TMPRSS4 antibody - middle region
Gene Names
TMPRSS4; CAPH2; MT-SP2; TMPRSS3
Reactivity
Tested Species Reactivity: HumanPredicted Species Reactivity: Human, Mouse, Rat, Dog, Horse, Pig
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TMPRSS4, Antibody; TMPRSS4 antibody - middle region; anti-TMPRSS4 antibody
Host
Rabbit
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Human, Mouse, Rat, Dog, Horse, Pig
Predicted Species Reactivity: Human, Mouse, Rat, Dog, Horse, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5mg/mL (varies by lot)
Sequence
Synthetic peptide located within the following region: LSGSLVSLHCLACGKSLKTPRVVGGEEASVDSWPWQVSIQYDKQHVCGGS
Sequence Length
432
Applicable Applications for anti-TMPRSS4 antibody
WB (Western Blot)
Homology
Dog: 85%; Horse: 85%; Human: 100%; Mouse: 93%; Pig: 85%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TMPRSS4
Protein Size (# AA)
432 amino acids
Protein Interactions
SYNE4; CCDC155; TMEM79; CLEC7A;
Blocking Peptide
For anti-TMPRSS4 (MBS3209467) antibody is Catalog #
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-TMPRSS4 antibody
This is a rabbit polyclonal antibody against TMPRSS4. It was validated on Western Blot
Target Description: This gene encodes a member of the serine protease family. Serine proteases are known to be involved in a variety of biological processes, whose malfunction often leads to human diseases and disorders. This gene was identified as a gene overexpressed in pancreatic carcinoma. The encoded protein is membrane bound with a N-terminal anchor sequence and a glycosylated extracellular region containing the serine protease domain. Multiple transcript variants encoding different isoforms have been found for this gene.
Target Description: This gene encodes a member of the serine protease family. Serine proteases are known to be involved in a variety of biological processes, whose malfunction often leads to human diseases and disorders. This gene was identified as a gene overexpressed in pancreatic carcinoma. The encoded protein is membrane bound with a N-terminal anchor sequence and a glycosylated extracellular region containing the serine protease domain. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-TMPRSS4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48kDa
NCBI Official Full Name
transmembrane protease serine 4 isoform 3
NCBI Official Synonym Full Names
transmembrane serine protease 4
NCBI Official Symbol
TMPRSS4
NCBI Official Synonym Symbols
CAPH2; MT-SP2; TMPRSS3
NCBI Protein Information
transmembrane protease serine 4
UniProt Protein Name
Transmembrane protease serine 4
UniProt Gene Name
TMPRSS4
UniProt Synonym Gene Names
TMPRSS3; CAPH2; MT-SP2
UniProt Entry Name
TMPS4_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The TMPRSS4 tmprss4 (Catalog #AAA200001) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TMPRSS4 antibody - middle region reacts with Tested Species Reactivity: Human Predicted Species Reactivity: Human, Mouse, Rat, Dog, Horse, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's TMPRSS4 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the TMPRSS4 tmprss4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LSGSLVSLHC LACGKSLKTP RVVGGEEASV DSWPWQVSIQ YDKQHVCGGS. It is sometimes possible for the material contained within the vial of "TMPRSS4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
