Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201666_WB13.jpg WB (Western Blot) (WB Suggested Anti-TNFRSF18 AntibodyTitration: 1 ug/mlPositive Control: Hela Whole Cell)

Rabbit anti-Human TNFRSF18 Polyclonal Antibody | anti-TNFRSF18 antibody

TNFRSF18 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
TNFRSF18; AITR; GITR; CD357; GITR-D
Reactivity
Human
Applications
Western Blot
Purity
Protein A purified
Synonyms
TNFRSF18, Antibody; TNFRSF18 antibody - C-terminal region; anti-TNFRSF18 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LHIWQLRKTQLLLEVPPSTEDARSCQFPEEERGERSAEEKGRLGDLWV
Sequence Length
234
Applicable Applications for anti-TNFRSF18 antibody
WB (Western Blot)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human TNFRSF18
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-TNFRSF18 AntibodyTitration: 1 ug/mlPositive Control: Hela Whole Cell)

product-image-AAA201666_WB13.jpg WB (Western Blot) (WB Suggested Anti-TNFRSF18 AntibodyTitration: 1 ug/mlPositive Control: Hela Whole Cell)

WB (Western Blot)

(Host: RabbitTarget Name: TNFRSF18Sample Tissue: Human HCT116Antibody Dilution: 1.0ug/ml)

product-image-AAA201666_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: TNFRSF18Sample Tissue: Human HCT116Antibody Dilution: 1.0ug/ml)
Related Product Information for anti-TNFRSF18 antibody
This is a rabbit polyclonal antibody against TNFRSF18. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The protein encoded by TNFRSF18 is a member of the TNF-receptor superfamily. This receptor has been shown to have increased expression upon T-cell activation, and it is thought to play a key role in dominant immunological self-tolerance maintained by CD25(+)CD4(+) regulatory T cells. Knockout studies in mice also suggest the role of this receptor is in the regulation of CD3-driven T-cell activation and programmed cell death.The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor has been shown to have increased expression upon T-cell activation, and it is thought to play a key role in dominant immunological self-tolerance maintained by CD25(+)CD4(+) regulatory T cells. Knockout studies in mice also suggest the role of this receptor is in the regulation of CD3-driven T-cell activation and programmed cell death. Three alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.
Product Categories/Family for anti-TNFRSF18 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
tumor necrosis factor receptor superfamily member 18 isoform 3
NCBI Official Synonym Full Names
TNF receptor superfamily member 18
NCBI Official Symbol
TNFRSF18
NCBI Official Synonym Symbols
AITR; GITR; CD357; GITR-D
NCBI Protein Information
tumor necrosis factor receptor superfamily member 18

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The TNFRSF18 (Catalog #AAA201666) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TNFRSF18 antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TNFRSF18 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the TNFRSF18 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LHIWQLRKTQ LLLEVPPSTE DARSCQFPEE ERGERSAEEK GRLGDLWV. It is sometimes possible for the material contained within the vial of "TNFRSF18, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.