IHC (Immunohistochemisry)
(TPH1/Tryptophan Hydroxylase Antibody-Human Colon: Formalin-Fixed, Paraffin-Embedded (FFPE))
Rabbit TPH1/Tryptophan Hydroxylase Polyclonal Antibody | anti-TPH1 antibody
TPH1/Tryptophan Hydroxylase Rabbit anti-Human Polyclonal Antibody
Gene Names
TPH1; TPRH; TRPH
Reactivity
Mouse, Rat, Human
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry
Purity
Affinity purified
Synonyms
TPH1/Tryptophan Hydroxylase, Antibody; TPH1/Tryptophan Hydroxylase Rabbit anti-Human Polyclonal Antibody; IHC-plus TPH1/Tryptophan Hydroxylase Antibody; TPH1; L-tryptophan hydroxylase; TRPH; Tryptophan 5-hydroxylase 1; Tryptophan 5-monooxygenase 1; TPRH; Tryptophan hydroxylase 1; TPH; anti-TPH1 antibody
Host
Rabbit
Reactivity
Mouse, Rat, Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Human TPH1/TPH
Purity/Purification
Affinity purified
Form/Format
PBS, pH7.3, 0.02% Sodium Azide, 50% Glycerol
Applicable Applications for anti-TPH1 antibody
WB (Western Blot), IHC (Immunohistochemistry), IHC (Immunohistochemistry)
Target
Human TPH1/Tryptophan Hydroxylase
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 345-444 of human TPH1 (NP_004170.1). LSGHAKVKPFDPKITCKQECLITTFQDVYFVSESFEDAKEKMREFTKTIKRPFGVKYNPYTRSIQILKDTKSITSAMNELQHDLDVVSDALAKVSRKPSI
Conjugation
Unconjugated
Family
Monooxygenase
Preparation and Storage
Store at -20 degree C. Avoid freeze-thaw cycles.
IHC (Immunohistochemisry)
(TPH1/Tryptophan Hydroxylase Antibody-Human Colon: Formalin-Fixed, Paraffin-Embedded (FFPE))
IHC (Immunohistochemisry)
(TPH1/Tryptophan Hydroxylase Antibody-Human Colon: Formalin-Fixed, Paraffin-Embedded (FFPE))
WB (Western Blot)
(TPH1/Tryptophan Hydroxylase Antibody-Western blot analysis of extracts of THP-1 cell lines, using TPH1 antibody.)
WB (Western Blot)
(TPH1/Tryptophan Hydroxylase Antibody-Western blot analysis of extracts of THP-1 cell lines, using TPH1 antibody.)
WB (Western Blot)
(TPH1/Tryptophan Hydroxylase Antibody-Western blot analysis of extracts of various cell lines, using TPH1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 10s.)
WB (Western Blot)
(TPH1/Tryptophan Hydroxylase Antibody-Western blot analysis of extracts of various cell lines, using TPH1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 10s.)
Related Product Information for anti-TPH1 antibody
Tryptophan Hydroxylase antibody is an unconjugated rabbit polyclonal antibody to Tryptophan Hydroxylase (TPH1) from human. It is reactive with human, mouse and rat. Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
50,985 Da
NCBI Official Full Name
tryptophan 5-hydroxylase 1
NCBI Official Synonym Full Names
tryptophan hydroxylase 1
NCBI Official Symbol
TPH1
NCBI Official Synonym Symbols
TPRH; TRPH
NCBI Protein Information
tryptophan 5-hydroxylase 1; L-tryptophan hydroxylase; tryptophan 5-monooxygenase 1; indoleacetic acid-5-hydroxylase; tryptophan hydroxylase (tryptophan 5-monooxygenase)
UniProt Protein Name
Tryptophan 5-hydroxylase 1
UniProt Gene Name
TPH1
UniProt Synonym Gene Names
TPH; TPRH; TRPH
UniProt Entry Name
TPH1_HUMAN
Similar Products
Product Notes
The TPH1 tph1 (Catalog #AAA162725) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TPH1/Tryptophan Hydroxylase Rabbit anti-Human Polyclonal Antibody reacts with Mouse, Rat, Human and may cross-react with other species as described in the data sheet. AAA Biotech's TPH1/Tryptophan Hydroxylase can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the TPH1 tph1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TPH1/Tryptophan Hydroxylase, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.