Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46530_IHC13.jpg IHC (Immunohiostchemistry) (TPP1 was detected in paraffin-embedded sections of human lung cancer tissues using rabbit anti- TPP1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

anti-Human TPP1 Polyclonal Antibody | anti-TPP1 antibody

Anti-TPP1 Antibody

Average rating 0.0
No ratings yet
Gene Names
TPP1; CLN2; GIG1; LPIC; SCAR7; TPP-1
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
TPP1, Antibody; Anti-TPP1 Antibody; Tripeptidyl-peptidase 1; Cell growth inhibiting gene 1 protein; Cell growth-inhibiting gene 1 protein; Ceroid lipofuscinosis neuronal 2; Ceroid lipofuscinosis neuronal 2 late infantile (Jansky Bielschowsky disease); Ceroid lipofuscinosis neuronal 2 late infantile; CLN 2; CLN2; GIG 1; GIG1; Growth inhibiting protein 1; LPIC; Lysosomal pepstatin insensitive protease; Lysosomal pepstatin-insensitive protease; MGC21297; TPP 1; TPP I; TPP-1; TPP-I; Tpp1; TPP1_HUMAN; TPPI; Tripeptidyl aminopeptidase; Tripeptidyl peptidase I; Tripeptidyl-peptidase I; tripeptidyl peptidase I; anti-TPP1 antibody
Ordering
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
563
Applicable Applications for anti-TPP1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human TPP1 (227-261aa CAQFLEQYFHDSDLAQFMRLFGGNFAHQASVARVV), different from the related mouse sequence by six amino acids, and from the related rat sequence by five amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohiostchemistry)

(TPP1 was detected in paraffin-embedded sections of human lung cancer tissues using rabbit anti- TPP1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46530_IHC13.jpg IHC (Immunohiostchemistry) (TPP1 was detected in paraffin-embedded sections of human lung cancer tissues using rabbit anti- TPP1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

WB (Western Blot)

(Western blot analysis of TPP1 expression in HELA whole cell lysates (lane 1). TPP1 at 61KD, 39KD was detected using rabbit anti- TPP1 Antigen Affinity purified polyclonal antibody at0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.)

product-image-AAA46530_WB15.jpg WB (Western Blot) (Western blot analysis of TPP1 expression in HELA whole cell lysates (lane 1). TPP1 at 61KD, 39KD was detected using rabbit anti- TPP1 Antigen Affinity purified polyclonal antibody at0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.)
Related Product Information for anti-TPP1 antibody
Description: Rabbit IgG polyclonal antibody for Tripeptidyl-peptidase 1(TPP1) detection. Tested with WB, IHC-P in Human.

Background: Tripeptidyl-peptidase 1, also known as Lysosomal pepstatin-insensitive protease, is an enzyme that in humans is encoded by the TPP1 gene. This gene encodes a member of the sedolisin family of serine proteases. The protease functions in the lysosome to cleave N-terminal tripeptides from substrates, and has weaker endopeptidase activity. It is synthesized as a catalytically-inactive enzyme which is activated and auto-proteolyzed upon acidification. Mutations in this gene result in late-infantile neuronal ceroid lipofuscinosis, which is associated with the failure to degrade specific neuropeptides and a subunit of ATP synthase in the lysosome.
References
1. "Entrez Gene: TPP1 tripeptidyl peptidase I". 2. Liu CG, Sleat DE, Donnelly RJ, Lobel P (Jun 1998). "Structural organization and sequence of CLN2, the defective gene in classical late infantile neuronal ceroid lipofuscinosis". Genomics 50 (2): 206-12.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34,464 Da
NCBI Official Full Name
tripeptidyl-peptidase 1 preproprotein
NCBI Official Synonym Full Names
tripeptidyl peptidase 1
NCBI Official Symbol
TPP1
NCBI Official Synonym Symbols
CLN2; GIG1; LPIC; SCAR7; TPP-1
NCBI Protein Information
tripeptidyl-peptidase 1
UniProt Protein Name
Tripeptidyl-peptidase 1
UniProt Gene Name
TPP1
UniProt Synonym Gene Names
CLN2; TPP-1; LPIC; TPP-I
UniProt Entry Name
TPP1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The TPP1 tpp1 (Catalog #AAA46530) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-TPP1 Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TPP1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the TPP1 tpp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TPP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.