Rabbit anti-Human TRAF3 Polyclonal Antibody | anti-TRAF3 antibody
TRAF3 Antibody - C-terminal region
Gene Names
TRAF3; CAP1; LAP1; CAP-1; CRAF1; IIAE5; CD40bp; RNF118
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
TRAF3, Antibody; TRAF3 Antibody - C-terminal region; anti-TRAF3 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENG
Sequence Length
167
Applicable Applications for anti-TRAF3 antibody
WB (Western Blot)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human TRAF3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-TRAF3 antibody
The protein encoded by this gene is a member of the TNF receptor associated factor (TRAF) protein family. TRAF proteins associate with, and mediate the signal transduction from, members of the TNF receptor (TNFR) superfamily. This protein participates in the signal transduction of CD40, a TNFR family member important for the activation of the immune response. This protein is found to be a critical component of the lymphotoxin-beta receptor (LTbetaR) signaling complex, which induces NF-kappaB activation and cell death initiated by LTbeta ligation. Epstein-Barr virus encoded latent infection membrane protein-1 (LMP1) can interact with this and several other members of the TRAF family, which may be essential for the oncogenic effects of LMP1. Several alternatively spliced transcript variants encoding three distinct isoforms have been reported.
Product Categories/Family for anti-TRAF3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64 kDa
NCBI Official Full Name
TNF receptor-associated factor 3
NCBI Official Synonym Full Names
TNF receptor associated factor 3
NCBI Official Symbol
TRAF3
NCBI Official Synonym Symbols
CAP1; LAP1; CAP-1; CRAF1; IIAE5; CD40bp; RNF118
NCBI Protein Information
TNF receptor-associated factor 3
UniProt Protein Name
TNF receptor-associated factor 3
UniProt Gene Name
TRAF3
UniProt Synonym Gene Names
CAP1; CRAF1; CRAF1; CD40BP; LAP1
UniProt Entry Name
TRAF3_HUMAN
Similar Products
Product Notes
The TRAF3 traf3 (Catalog #AAA201550) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TRAF3 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TRAF3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the TRAF3 traf3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MLMDQGSSRR HLGDAFKPDP NSSSFKKPTG EMNIASGCPV FVAQTVLENG. It is sometimes possible for the material contained within the vial of "TRAF3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
