Transferrin Polyclonal Antibody | anti-TF antibody

Anti-Transferrin Antibody

Cat. Num. AAA46442

• Gene Names: TF; TFQTL1; PRO1557; PRO2086; HEL-S-71p
• Reactivity: Human, Mouse, Rat
• Applications: Immunohistochemistry, Western Blot
• Purity: Immunogen Affinity Purified
• Synonyms: Transferrin, Antibody; Anti-Transferrin Antibody; Serotransferrin; Apotransferrin; Beta 1 metal binding globulin; Beta-1 metal-binding globulin; DKFZp781D0156; PRO1400; PRO1557; PRO2086; Serotransferrin precursor; Siderophilin; TF; TFQTL1; Transferin; Transferrin; transferrin; anti-TF antibody

• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 698

• Applicable Applications for anti-TF antibody: IHC (Immunohistochemistry), WB (Western Blot)
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Transferrin (20-49aa VPDKTVRWCAVSEHEATKCQSFRDHMKSVI), different from the related mouse and rat sequences by five amino acids.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemistry)

(Anti- Transferrin Picoband antibody, AAA46442,IHC(P)IHC(P): Human Intestinal Cancer Tissue)

IHC (Immunohistochemisry)

(Anti- Transferrin Picoband antibody, AAA46442,IHC(P)IHC(P): Rat Liver Tissue)

IHC (Immunohiostchemistry)

(Anti- Transferrin Picoband antibody, AAA46442,IHC(P)IHC(P): Mouse Liver Tissue)

WB (Western Blot)

(Anti- Transferrin Picoband antibody, AAA46442, Western blottingAll lanes: Anti Transferrin (AAA46442) at 0.5ug/mlLane 1: Rat Thymus Tissue Lysate at 50ugLane 2: Human Placenta Tissue Lysate at 50ugPredicted bind size: 77KDObserved bind size: 77KD)

Related Product Information for anti-TF antibody

Description: Rabbit IgG polyclonal antibody for Serotransferrin(TF) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: Transferrins are iron-binding blood plasma glycoproteins that control the level of free iron in biological fluids. In humans, it is encoded by the TF gene. Transferrin consists of a polypeptide chain containing 679 amino acids in humans. The protein is composed of alpha helices and beta sheets to form two domains. The N- and C- terminal sequences are represented by globular lobes and between the two lobes is an iron-binding site. Transferrin is a glycoprotein that binds iron very tightly but reversibly. Although iron bound to transferrin is less than 0.1% (4 mg) of the total body iron, it is the most important iron pool, with the highest rate of turnover (25 mg/24 h). And Transferrin has a molecular weight of around 80 kDa and contains 2 specific high-affinity Fe(III) binding sites. The affinity of transferrin for Fe(III) is extremely high (1023 Mˆ'1 at pH 7.4) but decreases progressively with decreasing pH below neutrality.

References

1. Asada-Senju, M., Maeda, T., Sakata, T., Hayashi, A., Suzuki, T.Molecular analysis of the transferrin gene in a patient with hereditary hypotransferrinemia.J. Hum. Genet. 47: 355-359, 2002. 2. Delanghe, J., Verstraelen, H., Pynaert, I., Debels, L., Taes, Y., Verhasselt, B., De Henauw, S., Temmerman, M.Human transferrin G277S mutation and iron deficiency in pregnancy. (Letter)Brit. J. Haemat. 132: 249-250, 2005. 3. Pang, H., Koda, Y., Soejima, M., Kimura, H.Identification of a mutation (A1879G) of transferrin from cDNA prepared from peripheral blood cells.Ann. Hum. Genet. 62: 271-274, 1998.

NCBI and Uniprot Product Information

• NCBI GI #: 4557871
• NCBI GeneID: 7018
• NCBI Accession #: NP_001054.1
• NCBI GenBank Nucleotide #: NM_001063.3
• UniProt Accession #: P02787; O43890; Q1HBA5; Q9NQB8; Q9UHV0
• Molecular Weight: 77,064 Da
• NCBI Official Full Name: serotransferrin
• NCBI Official Synonym Full Names: transferrin
• NCBI Official Symbol: TF
• NCBI Official Synonym Symbols: TFQTL1; PRO1557; PRO2086; HEL-S-71p
• NCBI Protein Information: serotransferrin
• UniProt Protein Name: Serotransferrin
• UniProt Gene Name: TF
• UniProt Synonym Gene Names: Transferrin
• UniProt Entry Name: TRFE_HUMAN