Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46442_IHC10.jpg IHC (Immunohistochemistry) (Anti- Transferrin Picoband antibody, AAA46442,IHC(P)IHC(P): Human Intestinal Cancer Tissue)

Transferrin Polyclonal Antibody | anti-TF antibody

Anti-Transferrin Antibody

Average rating 0.0
No ratings yet
Gene Names
TF; TFQTL1; PRO1557; PRO2086; HEL-S-71p
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
Transferrin, Antibody; Anti-Transferrin Antibody; Serotransferrin; Apotransferrin; Beta 1 metal binding globulin; Beta-1 metal-binding globulin; DKFZp781D0156; PRO1400; PRO1557; PRO2086; Serotransferrin precursor; Siderophilin; TF; TFQTL1; Transferin; Transferrin; transferrin; anti-TF antibody
Ordering
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
698
Applicable Applications for anti-TF antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human Transferrin (20-49aa VPDKTVRWCAVSEHEATKCQSFRDHMKSVI), different from the related mouse and rat sequences by five amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemistry)

(Anti- Transferrin Picoband antibody, AAA46442,IHC(P)IHC(P): Human Intestinal Cancer Tissue)

product-image-AAA46442_IHC10.jpg IHC (Immunohistochemistry) (Anti- Transferrin Picoband antibody, AAA46442,IHC(P)IHC(P): Human Intestinal Cancer Tissue)

IHC (Immunohistochemisry)

(Anti- Transferrin Picoband antibody, AAA46442,IHC(P)IHC(P): Rat Liver Tissue)

product-image-AAA46442_IHC11.jpg IHC (Immunohistochemisry) (Anti- Transferrin Picoband antibody, AAA46442,IHC(P)IHC(P): Rat Liver Tissue)

IHC (Immunohiostchemistry)

(Anti- Transferrin Picoband antibody, AAA46442,IHC(P)IHC(P): Mouse Liver Tissue)

product-image-AAA46442_IHC13.jpg IHC (Immunohiostchemistry) (Anti- Transferrin Picoband antibody, AAA46442,IHC(P)IHC(P): Mouse Liver Tissue)

WB (Western Blot)

(Anti- Transferrin Picoband antibody, AAA46442, Western blottingAll lanes: Anti Transferrin (AAA46442) at 0.5ug/mlLane 1: Rat Thymus Tissue Lysate at 50ugLane 2: Human Placenta Tissue Lysate at 50ugPredicted bind size: 77KDObserved bind size: 77KD)

product-image-AAA46442_WB15.jpg WB (Western Blot) (Anti- Transferrin Picoband antibody, AAA46442, Western blottingAll lanes: Anti Transferrin (AAA46442) at 0.5ug/mlLane 1: Rat Thymus Tissue Lysate at 50ugLane 2: Human Placenta Tissue Lysate at 50ugPredicted bind size: 77KDObserved bind size: 77KD)
Related Product Information for anti-TF antibody
Description: Rabbit IgG polyclonal antibody for Serotransferrin(TF) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: Transferrins are iron-binding blood plasma glycoproteins that control the level of free iron in biological fluids. In humans, it is encoded by the TF gene. Transferrin consists of a polypeptide chain containing 679 amino acids in humans. The protein is composed of alpha helices and beta sheets to form two domains. The N- and C- terminal sequences are represented by globular lobes and between the two lobes is an iron-binding site. Transferrin is a glycoprotein that binds iron very tightly but reversibly. Although iron bound to transferrin is less than 0.1% (4 mg) of the total body iron, it is the most important iron pool, with the highest rate of turnover (25 mg/24 h). And Transferrin has a molecular weight of around 80 kDa and contains 2 specific high-affinity Fe(III) binding sites. The affinity of transferrin for Fe(III) is extremely high (1023 Mˆ'1 at pH 7.4) but decreases progressively with decreasing pH below neutrality.
References
1. Asada-Senju, M., Maeda, T., Sakata, T., Hayashi, A., Suzuki, T.Molecular analysis of the transferrin gene in a patient with hereditary hypotransferrinemia.J. Hum. Genet. 47: 355-359, 2002. 2. Delanghe, J., Verstraelen, H., Pynaert, I., Debels, L., Taes, Y., Verhasselt, B., De Henauw, S., Temmerman, M.Human transferrin G277S mutation and iron deficiency in pregnancy. (Letter)Brit. J. Haemat. 132: 249-250, 2005. 3. Pang, H., Koda, Y., Soejima, M., Kimura, H.Identification of a mutation (A1879G) of transferrin from cDNA prepared from peripheral blood cells.Ann. Hum. Genet. 62: 271-274, 1998.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
77,064 Da
NCBI Official Full Name
serotransferrin
NCBI Official Synonym Full Names
transferrin
NCBI Official Symbol
TF
NCBI Official Synonym Symbols
TFQTL1; PRO1557; PRO2086; HEL-S-71p
NCBI Protein Information
serotransferrin
UniProt Protein Name
Serotransferrin
UniProt Gene Name
TF
UniProt Synonym Gene Names
Transferrin
UniProt Entry Name
TRFE_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The TF tf (Catalog #AAA46442) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-Transferrin Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Transferrin can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the TF tf for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Transferrin, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.