Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200783_WB8.jpg WB (Western Blot) (WB Suggested Anti-TRIM15 antibody Titration: 1 ug/mLSample Type: Human heart)

Rabbit TRIM15 Polyclonal Antibody | anti-TRIM15 antibody

TRIM15 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
TRIM15; RNF93; ZNFB7; ZNF178
Reactivity
Cow, Human, Pig, Rabbit, Yeast
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
TRIM15, Antibody; TRIM15 antibody - middle region; anti-TRIM15 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Human, Pig, Rabbit, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HLEIDSGVITLDPQTASRSLVLSEDRKSVRYTRQKKSLPDSPLRFDGLPA
Sequence Length
465
Applicable Applications for anti-TRIM15 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 86%; Human: 100%; Pig: 86%; Rabbit: 79%; Yeast: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TRIM15
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-TRIM15 antibody Titration: 1 ug/mLSample Type: Human heart)

product-image-AAA200783_WB8.jpg WB (Western Blot) (WB Suggested Anti-TRIM15 antibody Titration: 1 ug/mLSample Type: Human heart)

WB (Western Blot)

(WB Suggested Anti-TRIM15 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 721_B cell lysateTRIM15 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

product-image-AAA200783_WB10.jpg WB (Western Blot) (WB Suggested Anti-TRIM15 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 721_B cell lysateTRIM15 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

WB (Western Blot)

(Host: RabbitTarget Name: TRIM15Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

product-image-AAA200783_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: TRIM15Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: TRIM15Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

product-image-AAA200783_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: TRIM15Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-TRIM15 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult heartObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)

product-image-AAA200783_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-TRIM15 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult heartObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)
Related Product Information for anti-TRIM15 antibody
This is a rabbit polyclonal antibody against TRIM15. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TRIM15 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to the cytoplasm. Its function has not been identified. The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to the cytoplasm. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.
Product Categories/Family for anti-TRIM15 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52kDa
NCBI Official Full Name
tripartite motif-containing protein 15
NCBI Official Synonym Full Names
tripartite motif containing 15
NCBI Official Symbol
TRIM15
NCBI Official Synonym Symbols
RNF93; ZNFB7; ZNF178
NCBI Protein Information
tripartite motif-containing protein 15
UniProt Protein Name
Tripartite motif-containing protein 15
UniProt Gene Name
TRIM15
UniProt Synonym Gene Names
RNF93; ZNF178; ZNFB7

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The TRIM15 trim15 (Catalog #AAA200783) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TRIM15 antibody - middle region reacts with Cow, Human, Pig, Rabbit, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's TRIM15 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the TRIM15 trim15 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HLEIDSGVIT LDPQTASRSL VLSEDRKSVR YTRQKKSLPD SPLRFDGLPA. It is sometimes possible for the material contained within the vial of "TRIM15, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.