Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281596_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded Human colon using TRIM62 Rabbit pAb at dilution of 1:100 (40x lens).)

Rabbit TRIM62 Polyclonal Antibody | anti-TRIM62 antibody

TRIM62 Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
TRIM62; DEAR1; FLJ10759; FLJ16558
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
TRIM62, Antibody; TRIM62 Rabbit pAb; TRIM62; DEAR1; anti-TRIM62 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
HEQHQVTGIDDAFDELQRELKDQLQALQDSEREHTEALQLLKRQLAETKSSTKSLRTTIGEAFERLHRLLRERQKAMLEELEADTARTLTDIEQKVQRYSQQLRKVQEGAQILQERLAETDRHTFLAGVASLSERLKGKIHETNLTYEDFPTSKYTGPLQY
Applicable Applications for anti-TRIM62 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 120-280 of human TRIM62 (NP_060677.2).
Cellular Location
Cytoplasm
Positive Samples
A-431, Mouse brain
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded Human colon using TRIM62 Rabbit pAb at dilution of 1:100 (40x lens).)

product-image-AAA281596_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded Human colon using TRIM62 Rabbit pAb at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using TRIM62 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

product-image-AAA281596_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using TRIM62 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54,268 Da
NCBI Official Full Name
tripartite motif-containing protein 62
NCBI Official Synonym Full Names
tripartite motif containing 62
NCBI Official Symbol
TRIM62
NCBI Official Synonym Symbols
DEAR1; FLJ10759; FLJ16558
NCBI Protein Information
tripartite motif-containing protein 62; OTTHUMP00000004289; OTTHUMP00000004290; OTTHUMP00000004291; tripartite motif-containing 62; ductal epithelium-associated RING Chromosome 1
UniProt Protein Name
Tripartite motif-containing protein 62
UniProt Gene Name
TRIM62
UniProt Entry Name
TRI62_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The TRIM62 trim62 (Catalog #AAA281596) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TRIM62 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TRIM62 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the TRIM62 trim62 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: HEQHQVTGID DAFDELQREL KDQLQALQDS EREHTEALQL LKRQLAETKS STKSLRTTIG EAFERLHRLL RERQKAMLEE LEADTARTLT DIEQKVQRYS QQLRKVQEGA QILQERLAET DRHTFLAGVA SLSERLKGKI HETNLTYEDF PTSKYTGPLQ Y. It is sometimes possible for the material contained within the vial of "TRIM62, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.