Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282360_WB13.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using TRIM72 antibody (AAA282360) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 180s.)

Rabbit anti-Human, Mouse TRIM72 Polyclonal Antibody | anti-TRIM72 antibody

TRIM72 Rabbit pAb

Gene Names
TRIM72; MG53
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity purification
Synonyms
TRIM72, Antibody; TRIM72 Rabbit pAb; MG53; anti-TRIM72 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
Liquid
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
DAGVALRRELSSLNSYLEQLRQMEKVLEEVADKPQTEFLMKFCLVTSRLQKILSESPPPARLDIQLPVISDDFKFQVWKKMFRALMPALEELTFDPSSAHP
Applicable Applications for anti-TRIM72 antibody
WB (Western Blot)
Positive Samples
C2C12
Cellular Location
cytoplasm, sarcolemma
Research Area
Signal Transduction, Cell Biology & Developmental Biology
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 200-300 of mouse TRIM72 (NP_001073401.1).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Ship: Ice Pack

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using TRIM72 antibody (AAA282360) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 180s.)

product-image-AAA282360_WB13.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using TRIM72 antibody (AAA282360) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 180s.)

WB (Western Blot)

(Western blot analysis of extracts of C2C12 cells, using TRIM72 antibody (AAA282360) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s.)

product-image-AAA282360_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of C2C12 cells, using TRIM72 antibody (AAA282360) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s.)
Related Product Information for anti-TRIM72 antibody
Enables identical protein binding activity. Predicted to be involved in several processes, including cellular protein metabolic process; plasma membrane repair; and protein homooligomerization. Predicted to act upstream of or within negative regulation of insulin receptor signaling pathway; negative regulation of insulin-like growth factor receptor signaling pathway; and negative regulation of myotube differentiation. Predicted to be located in cytoplasmic vesicle membrane. Predicted to be active in cytoplasm and sarcolemma.
Product Categories/Family for anti-TRIM72 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29,501 Da
NCBI Official Full Name
tripartite motif-containing protein 72
NCBI Official Synonym Full Names
tripartite motif containing 72, E3 ubiquitin protein ligase
NCBI Official Symbol
TRIM72
NCBI Official Synonym Symbols
MG53
NCBI Protein Information
tripartite motif-containing protein 72; TRIM72; mitsugumin 53; mitsugumin-53; tripartite motif-containing 72
UniProt Protein Name
Tripartite motif-containing protein 72
UniProt Gene Name
TRIM72
UniProt Synonym Gene Names
Mg53
UniProt Entry Name
TRI72_HUMAN

Similar Products

Product Notes

The TRIM72 trim72 (Catalog #AAA282360) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TRIM72 Rabbit pAb reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's TRIM72 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the TRIM72 trim72 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: DAGVALRREL SSLNSYLEQL RQMEKVLEEV ADKPQTEFLM KFCLVTSRLQ KILSESPPPA RLDIQLPVIS DDFKFQVWKK MFRALMPALE ELTFDPSSAH P. It is sometimes possible for the material contained within the vial of "TRIM72, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.