Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197176_WB10.jpg WB (Western Blot) (WB Suggested Anti-TSFM Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysate.TSFM is strongly supported by BioGPS gene expression data to be expressed in HeLa)

Rabbit TSFM Polyclonal Antibody | anti-TSFM antibody

TSFM antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
TSFM; EFTS; EFTSMT
Reactivity
Cow, Guinea Pig, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TSFM, Antibody; TSFM antibody - middle region; anti-TSFM antibody
Ordering
Host
Rabbit
Reactivity
Cow, Guinea Pig, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GTMMHCQTLKDQPSAYSKGFLNSSELSGLPAGPDREGSLKDQLALAIGKL
Sequence Length
346
Applicable Applications for anti-TSFM antibody
WB (Western Blot)
Homology
Cow: 86%; Guinea Pig: 86%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TSFM
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-TSFM Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysate.TSFM is strongly supported by BioGPS gene expression data to be expressed in HeLa)

product-image-AAA197176_WB10.jpg WB (Western Blot) (WB Suggested Anti-TSFM Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysate.TSFM is strongly supported by BioGPS gene expression data to be expressed in HeLa)

WB (Western Blot)

(Host: RabbitTarget Name: TSFMSample Type: Human MCF7Antibody Dilution: 1.0ug/mlTSFM is strongly supported by BioGPS gene expression data to be expressed in MCF7)

product-image-AAA197176_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: TSFMSample Type: Human MCF7Antibody Dilution: 1.0ug/mlTSFM is strongly supported by BioGPS gene expression data to be expressed in MCF7)

WB (Western Blot)

(Host: RabbitTarget Name: TSFMSample Type: Human 721_BAntibody Dilution: 1.0ug/mlTSFM is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

product-image-AAA197176_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: TSFMSample Type: Human 721_BAntibody Dilution: 1.0ug/mlTSFM is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

WB (Western Blot)

(Host: RabbitTarget Name: TSFMSample Type: Human 293TAntibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that TSFM is expressed in HEK293T)

product-image-AAA197176_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: TSFMSample Type: Human 293TAntibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that TSFM is expressed in HEK293T)
Related Product Information for anti-TSFM antibody
This is a rabbit polyclonal antibody against TSFM. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The TSFM protein is a mitochondrial translation elongation factor. Synthesis of the 13 mitochondrial-encoded proteins occurs on a dedicated mitochondrial translation apparatus similar to that found in prokaryotes and requires, in addition to the tRNAs and rRNAs encoded in mtDNA, the concerted action of several translation factors and a large number of mitochondrial ribosomal proteins, all of which are encoded by nuclear genes.Synthesis of the 13 mitochondrial-encoded proteins occurs on a dedicated mitochondrial translation apparatus similar to that found in prokaryotes and requires, in addition to the tRNAs and rRNAs encoded in mtDNA, the concerted action of several translation factors and a large number of mitochondrial ribosomal proteins, all of which are encoded by nuclear genes. The TSFM gene encodes a mitochondrial translation elongation factor (Smeitink et al., 2006 [PubMed 17033963]).[supplied by OMIM].

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
elongation factor Ts, mitochondrial isoform 2
NCBI Official Synonym Full Names
Ts translation elongation factor, mitochondrial
NCBI Official Symbol
TSFM
NCBI Official Synonym Symbols
EFTS; EFTSMT
NCBI Protein Information
elongation factor Ts, mitochondrial
UniProt Protein Name
Elongation factor Ts, mitochondrial
UniProt Gene Name
TSFM
UniProt Entry Name
EFTS_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The TSFM tsfm (Catalog #AAA197176) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TSFM antibody - middle region reacts with Cow, Guinea Pig, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TSFM can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the TSFM tsfm for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GTMMHCQTLK DQPSAYSKGF LNSSELSGLP AGPDREGSLK DQLALAIGKL. It is sometimes possible for the material contained within the vial of "TSFM, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.