Rabbit anti-Human, Rat TSG6 Polyclonal Antibody | anti-TNFAIP6 antibody
Anti-TSG6 Antibody
Gene Names
TNFAIP6; TSG6; TSG-6
Reactivity
Human, Rat
Applications
Western Blot
Purity
Immunogen affinity purified.
Synonyms
TSG6, Antibody; Anti-TSG6 Antibody; TNFAIP 6; Tnfaip6; TSG 6; TSG-6; P98066; Tumor necrosis factor-inducible gene 6 protein; TNF alpha induced protein 6; anti-TNFAIP6 antibody
Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Isotype
IgG
Specificity
No cross reactivity with other proteins.
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
277
Applicable Applications for anti-TNFAIP6 antibody
WB (Western Blot)
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human TSG6 (46-91aa KYKLTYAEAKAVCEFEGGHLATYKQLEAARKIGFHVCAAGWMAKGR), different from the related mouse sequence by two amino acids.
Preparation and Storage
Store at -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
Related Product Information for anti-TNFAIP6 antibody
Tumor necrosis factor-inducible gene 6 protein, also known as TSG-6, is a protein that in humans is encoded by the TNFAIP6 gene. The protein encoded by this gene is a secretory protein that contains a hyaluronan-binding domain, and thus is a member of the hyaluronan-binding protein family. The hyaluronan-binding domain is known to be involved in extracellular matrix stability and cell migration. This protein has been shown to form a stable complex with inter-alpha-inhibitor (I alpha I), and thus enhance the serine protease inhibitory activity of I alpha I, which is important in the protease network associated with inflammation. This gene can be induced by proinflammatory cytokines such as tumor necrosis factor alpha and interleukin-1. Enhanced levels of this protein are found in the synovial fluid of patients with osteoarthritis and rheumatoid arthritis.
References
1. "Entrez Gene: TNFAIP6 tumor necrosis factor, alpha-induced protein 6".
2. Lee TH, Klampfer L, Shows TB, Vilcek J (March 1993). "Transcriptional regulation of TSG6, a tumor necrosis factor- and interleukin-1-inducible primary response gene coding for a secreted hyaluronan-binding protein". J. Biol. Chem. 268 (9): 6154-60.
3. Milner CM, Day AJ (2004). "TSG-6: a multifunctional protein associated with inflammation.". J. Cell. Sci. 116 (Pt 10): 1863-73.
2. Lee TH, Klampfer L, Shows TB, Vilcek J (March 1993). "Transcriptional regulation of TSG6, a tumor necrosis factor- and interleukin-1-inducible primary response gene coding for a secreted hyaluronan-binding protein". J. Biol. Chem. 268 (9): 6154-60.
3. Milner CM, Day AJ (2004). "TSG-6: a multifunctional protein associated with inflammation.". J. Cell. Sci. 116 (Pt 10): 1863-73.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
tumor necrosis factor-inducible gene 6 protein
NCBI Official Synonym Full Names
TNF alpha induced protein 6
NCBI Official Symbol
TNFAIP6
NCBI Official Synonym Symbols
TSG6; TSG-6
NCBI Protein Information
tumor necrosis factor-inducible gene 6 protein
UniProt Protein Name
Tumor necrosis factor-inducible gene 6 protein
UniProt Gene Name
TNFAIP6
UniProt Synonym Gene Names
TSG6; TSG-6; TNF alpha-induced protein 6
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The TNFAIP6 tnfaip6 (Catalog #AAA46749) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-TSG6 Antibody reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TSG6 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the TNFAIP6 tnfaip6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TSG6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
